Human ABHD6 ORF/cDNA clone-Lentivirus plasmid (NM_020676)

Cat. No.: pGMLP002704
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ABHD6/ Lentiviral expression plasmid for ABHD6 lentivirus packaging, ABHD6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ABHD6/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $583.92
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002704
Gene Name ABHD6
Accession Number NM_020676
Gene ID 57406
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1014 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCTTGATGTGGTTAACATGTTTGTGATTGCGGGCGGCACGCTGGCCATCCCAATCCTGGCATTTGTGGCTTCATTTCTTCTGTGGCCTTCAGCACTGATAAGAATCTATTATTGGTACTGGCGGAGGACATTGGGCATGCAAGTCCGCTATGTTCACCATGAAGACTATCAGTTCTGTTATTCCTTCCGGGGCAGGCCTGGGCACAAACCCTCCATCCTCATGCTCCACGGATTCTCTGCCCACAAGGATATGTGGCTCAGTGTGGTCAAGTTCCTTCCAAAGAACCTGCACTTGGTCTGCGTGGACATGCCAGGACATGAGGGCACCACCCGCTCCTCCCTGGATGACCTGTCCATAGATGGGCAAGTTAAGAGGATACACCAGTTTGTAGAATGCCTGAAGCTGAACAAAAAACCTTTCCACCTGGTAGGCACCTCCATGGGTGGCCAGGTGGCTGGGGTGTATGCTGCTTACTACCCATCGGATGTCTCCAGCCTGTGTCTCGTGTGTCCTGCTGGCCTGCAGTACTCAACTGACAATCAATTTGTACAACGGCTCAAAGAACTGCAGGGCTCTGCCGCCGTGGAGAAGATTCCCTTGATCCCGTCTACCCCAGAAGAGATGAGTGAAATGCTTCAGCTCTGCTCCTATGTCCGCTTCAAGGTGCCCCAGCAGATCCTGCAAGGCCTTGTCGATGTCCGCATCCCTCATAACAACTTCTACCGAAAGTTGTTTTTGGAAATCGTCAGTGAGAAGTCCAGATACTCTCTCCATCAGAACATGGACAAGATCAAGGTTCCGACGCAGATCATCTGGGGGAAACAAGACCAGGTGCTGGATGTGTCTGGGGCAGACATGTTGGCCAAGTCAATTGCCAACTGCCAGGTGGAGCTTCTGGAAAACTGTGGGCACTCAGTAGTGATGGAAAGACCCAGGAAGACAGCCAAGCTCATAATCGACTTTTTAGCTTCTGTGCACAACACAGACAACAACAAGAAGCTGGACTGA
ORF Protein Sequence MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T81452-Ab Anti-ABHD6 monoclonal antibody
    Target Antigen GM-Tg-g-T81452-Ag ABHD6 VLP (virus-like particle)
    ORF Viral Vector pGMLP002704 Human ABHD6 Lentivirus plasmid
    ORF Viral Vector vGMLP002704 Human ABHD6 Lentivirus particle


    Target information

    Target ID GM-T81452
    Target Name ABHD6
    Gene ID 57406, 66082, 702384, 305795, 101099621, 484712, 505283, 100057821
    Gene Symbol and Synonyms 0610041D24Rik,ABHD6
    Uniprot Accession Q9BV23
    Uniprot Entry Name ABHD6_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000163686
    Target Classification Not Available

    Enables acylglycerol lipase activity. Involved in acylglycerol catabolic process. Predicted to be located in late endosome membrane and lysosomal membrane. Predicted to be integral component of membrane. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in GABA-ergic synapse; glutamatergic synapse; and mitochondrion. Predicted to be integral component of postsynaptic membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.