Human CASQ2/PDIB2 ORF/cDNA clone-Lentivirus plasmid (NM_001232)

Cat. No.: pGMLP002728
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CASQ2/PDIB2 Lentiviral expression plasmid for CASQ2 lentivirus packaging, CASQ2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CASQ2/PDIB2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $636
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002728
Gene Name CASQ2
Accession Number NM_001232
Gene ID 845
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1200 bp
Gene Alias PDIB2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGAGAACTCACTTGTTTATTGTGGGGATTTATTTTCTGTCCTCTTGCAGGGCAGAAGAGGGGCTTAATTTCCCCACATATGATGGGAAGGACCGAGTGGTAAGTCTTTCCGAGAAGAACTTCAAGCAGGTTTTAAAGAAATATGACTTGCTTTGCCTCTACTACCATGAGCCGGTGTCTTCAGATAAGGTCACGCAAAAACAGTTCCAACTGAAAGAAATCGTGCTTGAGCTTGTGGCCCAGGTCCTTGAACATAAAGCTATAGGCTTTGTGATGGTGGATGCCAAGAAAGAAGCCAAGCTTGCCAAGAAACTGGGTTTTGATGAAGAAGGAAGCCTGTATATTCTTAAGGGTGATCGCACAATAGAGTTTGATGGCGAGTTTGCAGCTGATGTCTTGGTGGAGTTCCTCTTGGATCTAATTGAAGACCCAGTGGAGATCATCAGCAGCAAACTGGAAGTCCAAGCCTTCGAACGCATTGAAGACTACATCAAACTCATTGGCTTTTTCAAGAGTGAGGACTCAGAATACTACAAGGCTTTTGAAGAAGCAGCTGAACACTTCCAGCCTTACATCAAATTCTTTGCCACCTTTGACAAAGGGGTTGCAAAGAAATTATCTTTGAAGATGAATGAGGTTGACTTCTATGAGCCATTTATGGATGAGCCCATTGCCATCCCCAACAAACCTTACACAGAAGAGGAGCTGGTGGAGTTTGTGAAGGAACACCAAAGACCCACTCTACGTCGCCTGCGCCCAGAAGAAATGTTTGAAACATGGGAAGATGATTTGAATGGGATCCACATTGTGGCCTTTGCAGAGAAGAGTGATCCAGATGGCTACGAATTCCTGGAGATCCTGAAACAGGTTGCCCGGGACAATACTGACAACCCCGATCTGAGCATCCTGTGGATCGACCCGGACGACTTTCCTCTGCTCGTTGCCTACTGGGAGAAGACTTTCAAGATTGACCTATTCAGGCCACAGATTGGGGTGGTGAATGTCACAGATGCTGACAGTGTCTGGATGGAGATTCCAGATGATGACGATCTTCCAACTGCTGAGGAGCTGGAGGACTGGATTGAGGATGTGCTTTCTGGAAAGATAAACACTGAAGATGATGATGAAGATGATGATGATGATGATAATTCTGATGAAGAGGATAATGATGACAGTGATGACGATGATGATGAATAG
ORF Protein Sequence MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1474-Ab Anti-CASQ2/ PDIB2 functional antibody
    Target Antigen GM-Tg-g-SE1474-Ag CASQ2 protein
    ORF Viral Vector pGMLP002728 Human CASQ2 Lentivirus plasmid
    ORF Viral Vector vGMLP002728 Human CASQ2 Lentivirus particle


    Target information

    Target ID GM-SE1474
    Target Name CASQ2
    Gene ID 845, 12373, 712373, 29209, 101082678, 483134, 528555, 100059622
    Gene Symbol and Synonyms CAL,cardCSQ,CASQ2,cCSQ,Csq2,ESTM52,PDIB2
    Uniprot Accession O14958
    Uniprot Entry Name CASQ2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000118729
    Target Classification Not Available

    The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.