Human MAL ORF/cDNA clone-Lentivirus plasmid (NM_002371)
Cat. No.: pGMLP002779
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MAL/ Lentiviral expression plasmid for MAL lentivirus packaging, MAL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MAL/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002779 |
Gene Name | MAL |
Accession Number | NM_002371 |
Gene ID | 4118 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 462 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCCCCGCAGCGGCGACGGGGGGCAGCACCCTGCCCAGTGGCTTCTCGGTCTTCACCACCTTGCCCGACTTGCTCTTCATCTTTGAGTTTATCTTCGGGGGCCTGGTGTGGATCCTGGTGGCCTCCTCCCTGGTGCCCTGGCCCCTGGTCCAGGGCTGGGTGATGTTCGTGTCTGTGTTCTGCTTCGTGGCCACCACCACCTTGATCATCCTGTACATAATTGGAGCCCACGGTGGAGAGACTTCCTGGGTCACCTTGGACGCAGCCTACCACTGCACCGCTGCCCTCTTTTACCTCAGCGCCTCAGTCCTGGAGGCCCTGGCCACCATCACGATGCAAGACGGCTTCACCTACAGGCACTACCATGAAAACATTGCTGCCGTGGTGTTCTCCTACATAGCCACTCTGCTCTACGTGGTCCATGCGGTGTTCTCTTTAATCAGATGGAAGTCTTCATAA |
ORF Protein Sequence | MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1136-Ab | Anti-MAL monoclonal antibody |
Target Antigen | GM-Tg-g-IP1136-Ag | MAL protein |
ORF Viral Vector | pGMLP002779 | Human MAL Lentivirus plasmid |
ORF Viral Vector | vGMLP002779 | Human MAL Lentivirus particle |
Target information
Target ID | GM-IP1136 |
Target Name | MAL |
Gene ID | 4118, 17153, 703532, 25263, 101085795, 403933, 510077 |
Gene Symbol and Synonyms | MAL,MALGENE,Mpv17,MVP17,VIP17 |
Uniprot Accession | P21145 |
Uniprot Entry Name | MAL_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000172005 |
Target Classification | Not Available |
The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.