Human TUSC3/D8S1992/M33 ORF/cDNA clone-Lentivirus plasmid (NM_006765)

Cat. No.: pGMLP002831
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TUSC3/D8S1992/M33 Lentiviral expression plasmid for TUSC3 lentivirus packaging, TUSC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TUSC3/D8S1992 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $593.16
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002831
Gene Name TUSC3
Accession Number NM_006765
Gene ID 7991
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1047 bp
Gene Alias D8S1992,M33,MagT2,MRT22,MRT7,N33,OST3A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGCCCGGGGCGCTCCTTCACGCCGTAGGCAAGCGGGGCGGCGGCTGCGGTACCTGCCCACCGGGAGCTTTCCCTTCCTTCTCCTGCTGCTGCTGCTCTGCATCCAGCTCGGGGGAGGACAGAAGAAAAAGGAGAATCTTTTAGCTGAAAAAGTAGAGCAGCTGATGGAATGGAGTTCCAGACGCTCAATCTTCCGAATGAATGGTGATAAATTCCGAAAATTTATAAAGGCACCACCTCGAAACTATTCCATGATTGTTATGTTCACTGCTCTTCAGCCTCAGCGGCAGTGTTCTGTGTGCAGGCAAGCTAATGAAGAATATCAAATACTGGCGAACTCCTGGCGCTATTCATCTGCTTTTTGTAACAAGCTCTTCTTCAGTATGGTGGACTATGATGAGGGGACAGACGTTTTTCAGCAGCTCAACATGAACTCTGCTCCTACATTCATGCATTTTCCTCCAAAAGGCAGACCTAAGAGAGCTGATACTTTTGACCTCCAAAGAATTGGATTTGCAGCTGAGCAACTAGCAAAGTGGATTGCTGACAGAACGGATGTTCATATTCGGGTTTTCAGACCACCCAACTACTCTGGTACCATTGCTTTGGCCCTGTTAGTGTCGCTTGTTGGAGGTTTGCTTTATTTGAGAAGGAACAACTTGGAGTTCATCTATAACAAGACTGGTTGGGCCATGGTGTCTCTGTGTATAGTCTTTGCTATGACTTCTGGCCAGATGTGGAACCATATCCGTGGACCTCCATATGCTCATAAGAACCCACACAATGGACAAGTGAGCTACATTCATGGGAGCAGCCAGGCTCAGTTTGTGGCAGAATCACACATTATTCTGGTACTGAATGCCGCTATCACCATGGGGATGGTTCTTCTAAATGAAGCAGCAACTTCGAAAGGCGATGTTGGAAAAAGACGGATAATTTGCCTAGTGGGATTGGGCCTGGTGGTCTTCTTCTTCAGTTTTCTACTTTCAATATTTCGTTCCAAGTACCACGGCTATCCTTATAGTGATCTGGACTTTGAGTGA
ORF Protein Sequence MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1894-Ab Anti-TUSC3/ D8S1992/ M33 monoclonal antibody
    Target Antigen GM-Tg-g-MP1894-Ag TUSC3 VLP (virus-like particle)
    ORF Viral Vector pGMLP002831 Human TUSC3 Lentivirus plasmid
    ORF Viral Vector vGMLP002831 Human TUSC3 Lentivirus particle


    Target information

    Target ID GM-MP1894
    Target Name TUSC3
    Gene ID 7991, 80286, 701123, 290783, 101081724, 475608, 615007, 100049974
    Gene Symbol and Synonyms D8S1992,M33,MagT2,MRT22,MRT7,N33,OST3A,SLC58A2,TUSC3
    Uniprot Accession Q13454
    Uniprot Entry Name TUSC3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000104723
    Target Classification Not Available

    This gene encodes a protein that has been associated with several biological functions including cellular magnesium uptake, protein glycosylation and embryonic development. This protein localizes to the endoplasmic reticulum and acts as a component of the oligosaccharyl transferase complex which is responsible for N-linked protein glycosylation. This gene is a candidate tumor suppressor gene. Homozygous mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation-7 and in the proliferation and invasiveness of several cancers including metastatic pancreatic cancer, ovarian cancer and glioblastoma multiform. [provided by RefSeq, Oct 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.