Human TDGF1/CR/CRGF ORF/cDNA clone-Lentivirus plasmid (NM_003212)

Cat. No.: pGMLP002878
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TDGF1/CR/CRGF Lentiviral expression plasmid for TDGF1 lentivirus packaging, TDGF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TDGF1/CR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002878
Gene Name TDGF1
Accession Number NM_003212
Gene ID 6997
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 567 bp
Gene Alias CR,CRGF,CRIPTO
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACTGCAGGAAGATGGCCCGCTTCTCTTACAGTGTGATTTGGATCATGGCCATTTCTAAAGTCTTTGAACTGGGATTAGTTGCCGGGCTGGGCCATCAGGAATTTGCTCGTCCATCTCGGGGATACCTGGCCTTCAGAGATGACAGCATTTGGCCCCAGGAGGAGCCTGCAATTCGGCCTCGGTCTTCCCAGCGTGTGCCGCCCATGGGGATACAGCACAGTAAGGAGCTAAACAGAACCTGCTGCCTGAATGGGGGAACCTGCATGCTGGGGTCCTTTTGTGCCTGCCCTCCCTCCTTCTACGGACGGAACTGTGAGCACGATGTGCGCAAAGAGAACTGTGGGTCTGTGCCCCATGACACCTGGCTGCCCAAGAAGTGTTCCCTGTGTAAATGCTGGCACGGTCAGCTCCGCTGCTTTCCTCAGGCATTTCTACCCGGCTGTGATGGCCTTGTGATGGATGAGCACCTCGTGGCTTCCAGGACTCCAGAACTACCACCGTCTGCACGTACTACCACTTTTATGCTAGTTGGCATCTGCCTTTCTATACAAAGCTACTATTAA
ORF Protein Sequence MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T47864-Ab Anti-TDGF1/ CR/ CR-1 monoclonal antibody
    Target Antigen GM-Tg-g-T47864-Ag TDGF1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002878 Human TDGF1 Lentivirus plasmid
    ORF Viral Vector vGMLP002878 Human TDGF1 Lentivirus particle


    Target information

    Target ID GM-T47864
    Target Name TDGF1
    Gene ID 6997, 21667, 712918, 680246, 101093999, 482156, 784029, 100065218
    Gene Symbol and Synonyms CR,CR-1,CR1,CRGF,CRIPTO,TDGF1
    Uniprot Accession P13385
    Uniprot Entry Name TDGF1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000241186
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.