Human PHB/HEL-215/HEL-S-54e ORF/cDNA clone-Lentivirus plasmid (NM_002634)

Cat. No.: pGMLP002964
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PHB/HEL-215/HEL-S-54e Lentiviral expression plasmid for PHB lentivirus packaging, PHB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PHB/HEL-215 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $504.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002964
Gene Name PHB
Accession Number NM_002634
Gene ID 5245
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 819 bp
Gene Alias HEL-215,HEL-S-54e,PHB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCAAAGTGTTTGAGTCCATTGGCAAGTTTGGCCTGGCCTTAGCTGTTGCAGGAGGCGTGGTGAACTCTGCCTTATATAATGTGGATGCTGGGCACAGAGCTGTCATCTTTGACCGATTCCGTGGAGTGCAGGACATTGTGGTAGGGGAAGGGACTCATTTTCTCATCCCGTGGGTACAGAAACCAATTATCTTTGACTGCCGTTCTCGACCACGTAATGTGCCAGTCATCACTGGTAGCAAAGATTTACAGAATGTCAACATCACACTGCGCATCCTCTTCCGGCCTGTCGCCAGCCAGCTTCCTCGCATCTTCACCAGCATCGGAGAGGACTATGATGAGCGTGTGCTGCCGTCCATCACAACTGAGATCCTCAAGTCAGTGGTGGCTCGCTTTGATGCTGGAGAACTAATCACCCAGAGAGAGCTGGTCTCCAGGCAGGTGAGCGACGACCTTACAGAGCGAGCCGCCACCTTTGGGCTCATCCTGGATGACGTGTCCTTGACACATCTGACCTTCGGGAAGGAGTTCACAGAAGCGGTGGAAGCCAAACAGGTGGCTCAGCAGGAAGCAGAGAGGGCCAGATTTGTGGTGGAAAAGGCTGAGCAACAGAAAAAGGCGGCCATCATCTCTGCTGAGGGCGACTCCAAGGCAGCTGAGCTGATTGCCAACTCACTGGCCACTGCAGGGGATGGCCTGATCGAGCTGCGCAAGCTGGAAGCTGCAGAGGACATCGCGTACCAGCTCTCACGCTCTCGGAACATCACCTACCTGCCAGCGGGGCAGTCCGTGCTCCTCCAGCTGCCCCAGTGA
ORF Protein Sequence MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96396-Ab Anti-PHB1/ PHB/ PHB; HEL-215; HEL-S-54e monoclonal antibody
    Target Antigen GM-Tg-g-T96396-Ag PHB/PHB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002964 Human PHB Lentivirus plasmid
    ORF Viral Vector vGMLP002964 Human PHB Lentivirus particle


    Target information

    Target ID GM-T96396
    Target Name PHB
    Gene ID 5245, 18673, 699334, 25344, 100126580, 480547, 530409, 100056039
    Gene Symbol and Synonyms Bap32,HEL-215,HEL-S-54e,PHB,PHB1,ZNF607
    Uniprot Accession P35232
    Uniprot Entry Name PHB1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000167085
    Target Classification Not Available

    This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.