Human REG3A/HIP/HIP/PAP ORF/cDNA clone-Lentivirus plasmid (NM_002580)

Cat. No.: pGMLP002976
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human REG3A/HIP/HIP/PAP Lentiviral expression plasmid for REG3A lentivirus packaging, REG3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to REG3A/HIP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002976
Gene Name REG3A
Accession Number NM_002580
Gene ID 5068
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 528 bp
Gene Alias HIP,HIP/PAP,INGAP,PAP,PAP-H,PAP1,PBCGF,REG-III,REG3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCCTCCCATGGCCCTGCCCAGTGTATCTTGGATGCTGCTTTCCTGCCTCATGCTGCTGTCTCAGGTTCAAGGTGAAGAACCCCAGAGGGAACTGCCCTCTGCACGGATCCGCTGTCCCAAAGGCTCCAAGGCCTATGGCTCCCACTGCTATGCCTTGTTTTTGTCACCAAAATCCTGGACAGATGCAGATCTGGCCTGCCAGAAGCGGCCCTCTGGAAACCTGGTGTCTGTGCTCAGTGGGGCTGAGGGATCCTTCGTGTCCTCCCTGGTGAAGAGCATTGGTAACAGCTACTCATACGTCTGGATTGGGCTCCATGACCCCACACAGGGCACCGAGCCCAATGGAGAAGGTTGGGAGTGGAGTAGCAGTGATGTGATGAATTACTTTGCATGGGAGAGAAATCCCTCCACCATCTCAAGCCCCGGCCACTGTGCGAGCCTGTCGAGAAGCACAGCATTTCTGAGGTGGAAAGATTATAACTGTAATGTGAGGTTACCCTATGTCTGCAAGTTCACTGACTAG
ORF Protein Sequence MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T92030-Ab Anti-REG3A/ HIP/ HIP/PAP functional antibody
    Target Antigen GM-Tg-g-T92030-Ag REG3A protein
    ORF Viral Vector pGMLP002976 Human REG3A Lentivirus plasmid
    ORF Viral Vector vGMLP002976 Human REG3A Lentivirus particle


    Target information

    Target ID GM-T92030
    Target Name REG3A
    Gene ID 5068
    Gene Symbol and Synonyms HIP,HIP/PAP,INGAP,PAP,PAP-H,PAP1,PBCGF,REG-III,REG3,REG3A
    Uniprot Accession Q06141
    Uniprot Entry Name REG3A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Pancreas Cancer, Other obstructive and reflux uropathy
    Gene Ensembl ENSG00000172016
    Target Classification Not Available

    This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.