Human REG3A/HIP/HIP/PAP ORF/cDNA clone-Lentivirus particle (NM_002580)
Cat. No.: vGMLP002976
Pre-made Human REG3A/HIP/HIP/PAP Lentiviral expression plasmid for REG3A lentivirus packaging, REG3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
REG3A/HIP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002976 | Human REG3A Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002976 |
Gene Name | REG3A |
Accession Number | NM_002580 |
Gene ID | 5068 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 528 bp |
Gene Alias | HIP,HIP/PAP,INGAP,PAP,PAP-H,PAP1,PBCGF,REG-III,REG3 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGCCTCCCATGGCCCTGCCCAGTGTATCTTGGATGCTGCTTTCCTGCCTCATGCTGCTGTCTCAGGTTCAAGGTGAAGAACCCCAGAGGGAACTGCCCTCTGCACGGATCCGCTGTCCCAAAGGCTCCAAGGCCTATGGCTCCCACTGCTATGCCTTGTTTTTGTCACCAAAATCCTGGACAGATGCAGATCTGGCCTGCCAGAAGCGGCCCTCTGGAAACCTGGTGTCTGTGCTCAGTGGGGCTGAGGGATCCTTCGTGTCCTCCCTGGTGAAGAGCATTGGTAACAGCTACTCATACGTCTGGATTGGGCTCCATGACCCCACACAGGGCACCGAGCCCAATGGAGAAGGTTGGGAGTGGAGTAGCAGTGATGTGATGAATTACTTTGCATGGGAGAGAAATCCCTCCACCATCTCAAGCCCCGGCCACTGTGCGAGCCTGTCGAGAAGCACAGCATTTCTGAGGTGGAAAGATTATAACTGTAATGTGAGGTTACCCTATGTCTGCAAGTTCACTGACTAG |
ORF Protein Sequence | MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T92030-Ab | Anti-REG3A/ HIP/ HIP/PAP functional antibody |
Target Antigen | GM-Tg-g-T92030-Ag | REG3A protein |
ORF Viral Vector | pGMLP002976 | Human REG3A Lentivirus plasmid |
ORF Viral Vector | vGMLP002976 | Human REG3A Lentivirus particle |
Target information
Target ID | GM-T92030 |
Target Name | REG3A |
Gene ID | 5068 |
Gene Symbol and Synonyms | HIP,HIP/PAP,INGAP,PAP,PAP-H,PAP1,PBCGF,REG-III,REG3,REG3A |
Uniprot Accession | Q06141 |
Uniprot Entry Name | REG3A_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Pancreas Cancer, Other obstructive and reflux uropathy |
Gene Ensembl | ENSG00000172016 |
Target Classification | Not Available |
This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.