Human RNF5/RING5/RMA1 ORF/cDNA clone-Lentivirus plasmid (NM_006913)

Cat. No.: pGMLP003006
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNF5/RING5/RMA1 Lentiviral expression plasmid for RNF5 lentivirus packaging, RNF5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RNF5/RING5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $435.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003006
Gene Name RNF5
Accession Number NM_006913
Gene ID 6048
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 543 bp
Gene Alias RING5,RMA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCAGCGGAGGAGGAGGACGGGGGCCCCGAAGGGCCAAATCGCGAGCGGGGCGGGGCGGGCGCGACCTTCGAATGTAATATATGTTTGGAGACTGCTCGGGAAGCTGTGGTCAGTGTGTGTGGCCACCTGTACTGTTGGCCATGTCTTCATCAGTGGCTGGAGACACGGCCAGAACGGCAAGAGTGTCCAGTATGTAAAGCTGGGATCAGCAGAGAGAAGGTTGTCCCGCTTTATGGGCGAGGGAGCCAGAAGCCCCAGGATCCCAGATTAAAAACTCCACCCCGCCCCCAGGGCCAGAGACCAGCTCCGGAGAGCAGAGGGGGATTCCAGCCATTTGGTGATACCGGGGGCTTCCACTTCTCATTTGGTGTTGGTGCTTTTCCCTTTGGCTTTTTCACCACCGTCTTCAATGCCCATGAGCCTTTCCGCCGGGGTACAGGTGTGGATCTGGGACAGGGTCACCCAGCCTCCAGCTGGCAGGATTCCCTCTTCCTGTTTCTCGCCATCTTCTTCTTTTTTTGGCTGCTCAGTATTTGA
ORF Protein Sequence MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1466-Ab Anti-RNF5/ RING5/ RMA1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1466-Ag RNF5 VLP (virus-like particle)
    ORF Viral Vector pGMLP003006 Human RNF5 Lentivirus plasmid
    ORF Viral Vector vGMLP003006 Human RNF5 Lentivirus particle


    Target information

    Target ID GM-MP1466
    Target Name RNF5
    Gene ID 6048, 54197, 717234, 407784, 101096477, 474858, 616187, 100051626
    Gene Symbol and Synonyms 2410131O05Rik,NG2,RING5,RMA1,RNF5
    Uniprot Accession Q99942
    Uniprot Entry Name RNF5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000204308
    Target Classification Not Available

    The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.