Human ADIPOR1/ACDCR1/CGI-45 ORF/cDNA clone-Lentivirus plasmid (NM_015999)

Cat. No.: pGMLP003026
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ADIPOR1/ACDCR1/CGI-45 Lentiviral expression plasmid for ADIPOR1 lentivirus packaging, ADIPOR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ADIPOR1/ACDCR1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $615.84
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003026
Gene Name ADIPOR1
Accession Number NM_015999
Gene ID 51094
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1128 bp
Gene Alias ACDCR1,CGI-45,CGI45,PAQR1,TESBP1A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACACGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCCCATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCCATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCAGGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGCCACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGGCGTGTTCCTGGGACTTGGCTTGAGTGGCGTCGTGCCCACCATGCACTTTACTATCGCTGAGGGCTTTGTCAAGGCCACCACAGTGGGCCAGATGGGCTGGTTCTTCCTCATGGCTGTGATGTACATCACTGGAGCTGGCCTTTATGCTGCTCGAATTCCTGAGCGCTTCTTTCCTGGAAAATTTGACATATGGTTCCAGTCTCATCAGATTTTCCATGTCCTGGTGGTGGCAGCAGCCTTTGTCCACTTCTATGGAGTCTCCAACCTTCAGGAATTCCGTTACGGCCTAGAAGGCGGCTGTACTGATGACACCCTTCTCTGA
ORF Protein Sequence MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA064-Ab Anti-PAQR1/ ADIPOR1/ ACDCR1 monoclonal antibody
    Target Antigen GM-Tg-g-TA064-Ag ADIPOR1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003026 Human ADIPOR1 Lentivirus plasmid
    ORF Viral Vector vGMLP003026 Human ADIPOR1 Lentivirus particle


    Target information

    Target ID GM-TA064
    Target Name ADIPOR1
    Gene ID 51094, 72674, 704626, 289036, 100187713, 479995, 407235, 100052436
    Gene Symbol and Synonyms 2810031L11Rik,ACDCR1,ADIPOR1,CGI-45,CGI45,PAQR1,TESBP1A
    Uniprot Accession Q96A54
    Uniprot Entry Name PAQR1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000159346
    Target Classification Not Available

    This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.