Human CDC42SE1/SCIP1/SPEC1 ORF/cDNA clone-Lentivirus plasmid (NM_020239)

Cat. No.: pGMLP003041
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDC42SE1/SCIP1/SPEC1 Lentiviral expression plasmid for CDC42SE1 lentivirus packaging, CDC42SE1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CDC42SE1/SCIP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003041
Gene Name CDC42SE1
Accession Number NM_020239
Gene ID 56882
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 240 bp
Gene Alias SCIP1,SPEC1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGAATTTTGGCACAAACTGGGCTGCTGTGTGGTAGAGAAACCCCAGCCGAAGAAGAAGAGAAGACGGATTGACCGGACCATGATTGGGGAACCAATGAATTTTGTTCACCTGACTCACATTGGCTCAGGGGAGATGGGGGCCGGAGATGGACTTGCCATGACAGGTGCAGTTCAGGAGCAGATGAGATCCAAGGGAAACCGAGATAGGCCATGGAGCAATTCTAGGGGCTTATAG
ORF Protein Sequence MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2046-Ab Anti-C42S1/ CDC42SE1/ SCIP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP2046-Ag CDC42SE1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003041 Human CDC42SE1 Lentivirus plasmid
    ORF Viral Vector vGMLP003041 Human CDC42SE1 Lentivirus particle


    Target information

    Target ID GM-MP2046
    Target Name CDC42SE1
    Gene ID 56882, 57912, 100427784, 499672, 101095840, 608900, 614042, 100629318
    Gene Symbol and Synonyms 1300002M12Rik,CDC42SE1,Cdcse1,SCIP1,SPEC1
    Uniprot Accession Q9NRR8
    Uniprot Entry Name C42S1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197622
    Target Classification Not Available

    Predicted to enable GTPase inhibitor activity. Predicted to be involved in signal transduction. Located in cell junction. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.