Human KLRG1/2F1/CLEC15A ORF/cDNA clone-Lentivirus plasmid (NM_001329099)

Cat. No.: pGMLP003130
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLRG1/2F1/CLEC15A Lentiviral expression plasmid for KLRG1 lentivirus packaging, KLRG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KLRG1/2F1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $447
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003130
Gene Name KLRG1
Accession Number NM_001329099
Gene ID 10219
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 588 bp
Gene Alias 2F1,CLEC15A,MAFA,MAFA-2F1,MAFA-L,MAFA-LIKE
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGACAGTGTTATTTATTCCATGTTAGAGTTGCCTACGGCAACCCAAGCCCAGAATGACTATGGACCACAGCAAAAATCTTCCTCTTCCAGGCCTTCTTGTTCTTGCCTTGTGGCAATAGCTTTGGGGCTTCTGACTGCAGTTCTTCTGAGTGTGCTGCTATACCAGTGGATCCTGTGCCAGGGCTCCAACTACTCCACTTGTGCCAGCTGTCCTAGCTGCCCAGACCGCTGGATGAAATATGGTAACCATTGTTATTATTTCTCAGTGGAGGAAAAGGACTGGAATTCTAGTCTGGAATTCTGCCTAGCCAGAGACTCACACCTCCTTGTGATAACGGACAATCAGGAAATGAGCCTGCTCCAAGTTTTCCTCAGTGAGGCCTTTTGCTGGATTGGTCTGAGGAACAATTCTGGCTGGAGGTGGGAAGATGGATCACCTCTAAACTTCTCAAGGATTTCTTCTAATAGCTTTGTGCAGACATGCGGTGCCATCAACAAAAATGGTCTTCAAGCCTCAAGCTGTGAAGTTCCTTTACACTGGGTGTGTAAGAAGTGTCCCTTTGCAGATCAAGCTTTATTCTGA
ORF Protein Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO082-Ab Anti-KLRG1/ 2F1/ CLEC15A monoclonal antibody
    Target Antigen GM-Tg-g-IO082-Ag KLRG1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003130 Human KLRG1 Lentivirus plasmid
    ORF Viral Vector vGMLP003130 Human KLRG1 Lentivirus particle


    Target information

    Target ID GM-IO082
    Target Name KLRG1
    Gene ID 10219, 50928, 716727, 58975, 101098640, 611464, 100295672, 100053516
    Gene Symbol and Synonyms 2F1,2F1-Ag,CLEC15A,KLRG1,MAFA,MAFA-2F1,MAFA-L,MAFA-LIKE
    Uniprot Accession Q96E93
    Uniprot Entry Name KLRG1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Not Available
    Gene Ensembl ENSG00000139187
    Target Classification Checkpoint-Immuno Oncology

    Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. [provided by RefSeq, Jun 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.