Human APELA/ELA/Ende ORF/cDNA clone-Lentivirus plasmid (NM_001297550)
Cat. No.: pGMLP003153
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human APELA/ELA/Ende Lentiviral expression plasmid for APELA lentivirus packaging, APELA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
APELA/ELA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003153 |
Gene Name | APELA |
Accession Number | NM_001297550 |
Gene ID | 100506013 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 165 bp |
Gene Alias | ELA,Ende,tdl |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGATTTCAGCAATTCCTTTTTGCATTTTTTATTTTTATTATGAGTCTTCTCCTTATCAGCGGACAGAGACCAGTTAATTTGACCATGAGAAGAAAACTGCGCAAACACAATTGCCTTCAGAGGAGATGTATGCCTCTCCATTCACGAGTACCCTTTCCCTGA |
ORF Protein Sequence | MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0670-Ab | Anti-ELA/ APELA/ Ende functional antibody |
Target Antigen | GM-Tg-g-SE0670-Ag | APELA protein |
ORF Viral Vector | pGMLP003153 | Human APELA Lentivirus plasmid |
ORF Viral Vector | vGMLP003153 | Human APELA Lentivirus particle |
Target information
Target ID | GM-SE0670 |
Target Name | APELA |
Gene ID | 100506013, 100038489, 106998564, 103693925, 105260494, 102153003, 101905445, 106782838 |
Gene Symbol and Synonyms | APELA,ELA,Elabela,Ende,Gm10664,tdl |
Uniprot Accession | P0DMC3 |
Uniprot Entry Name | ELA_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000248329 |
Target Classification | Not Available |
This gene encodes a peptide hormone that binds to the Apelin receptor. The encoded protein is required for heart development in zebrafish and has been shown to maintain self-renewal of human embryonic stem cells through activation of the PI3K/AKT pathway. Experiments in human and mouse cell lines point to additional roles for the encoded protein in angiogenesis and regulation of vascular tone. [provided by RefSeq, Jul 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.