Human APELA/ELA/Ende ORF/cDNA clone-Lentivirus particle (NM_001297550)

Cat. No.: vGMLP003153

Pre-made Human APELA/ELA/Ende Lentiviral expression plasmid for APELA lentivirus packaging, APELA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to APELA/ELA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003153 Human APELA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003153
Gene Name APELA
Accession Number NM_001297550
Gene ID 100506013
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 165 bp
Gene Alias ELA,Ende,tdl
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGATTTCAGCAATTCCTTTTTGCATTTTTTATTTTTATTATGAGTCTTCTCCTTATCAGCGGACAGAGACCAGTTAATTTGACCATGAGAAGAAAACTGCGCAAACACAATTGCCTTCAGAGGAGATGTATGCCTCTCCATTCACGAGTACCCTTTCCCTGA
ORF Protein Sequence MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0670-Ab Anti-ELA/ APELA/ Ende functional antibody
    Target Antigen GM-Tg-g-SE0670-Ag APELA protein
    ORF Viral Vector pGMLP003153 Human APELA Lentivirus plasmid
    ORF Viral Vector vGMLP003153 Human APELA Lentivirus particle


    Target information

    Target ID GM-SE0670
    Target Name APELA
    Gene ID 100506013, 100038489, 106998564, 103693925, 105260494, 102153003, 101905445, 106782838
    Gene Symbol and Synonyms APELA,ELA,Elabela,Ende,Gm10664,tdl
    Uniprot Accession P0DMC3
    Uniprot Entry Name ELA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000248329
    Target Classification Not Available

    This gene encodes a peptide hormone that binds to the Apelin receptor. The encoded protein is required for heart development in zebrafish and has been shown to maintain self-renewal of human embryonic stem cells through activation of the PI3K/AKT pathway. Experiments in human and mouse cell lines point to additional roles for the encoded protein in angiogenesis and regulation of vascular tone. [provided by RefSeq, Jul 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.