Human MSMB/HPC13/IGBF ORF/cDNA clone-Lentivirus plasmid (NM_138634)
Cat. No.: pGMLP003371
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MSMB/HPC13/IGBF Lentiviral expression plasmid for MSMB lentivirus packaging, MSMB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MSMB/HPC13 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003371 |
Gene Name | MSMB |
Accession Number | NM_138634 |
Gene ID | 4477 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 234 bp |
Gene Alias | HPC13,IGBF,MSP,MSPB,PN44,PRPS,PSP,PSP-94,PSP57,PSP94 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAATGTTCTCCTGGGCAGCGTTGTGATCTTTGCCACCTTCGTGACTTTATGCAATGCATCATGCTATTTCATACCTAATGAGGGAGTTCCAGGAGATTCAACCAGGATGTTTCTACACCTGTGGGTTATGACAAAGACAACTGCCAAAGAATCTTCAAGAAGGAGGACTGCAAGTATATCGTGGTGGAGAAGAAGGACCCAAAAAAGACCTGTTCTGTCAGTGAATGGATAA |
ORF Protein Sequence | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRMFLHLWVMTKTTAKESSRRRTASISWWRRRTQKRPVLSVNG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T07374-Ab | Anti-MSMB/ HPC13/ IGBF functional antibody |
Target Antigen | GM-Tg-g-T07374-Ag | MSMB protein |
ORF Viral Vector | pGMLP003371 | Human MSMB Lentivirus plasmid |
ORF Viral Vector | vGMLP003371 | Human MSMB Lentivirus particle |
Target information
Target ID | GM-T07374 |
Target Name | MSMB |
Gene ID | 4477, 17695, 709332, 29311, 102901471, 616019, 100629874 |
Gene Symbol and Synonyms | beta-MSP,HPC13,IGBF,MSMB,MSP,MSPB,PIP,PN44,PRPS,PSP,PSP-94,PSP57,PSP94 |
Uniprot Accession | P08118 |
Uniprot Entry Name | MSMB_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Prostate disease |
Gene Ensembl | ENSG00000263639 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.