Human MSMB/HPC13/IGBF ORF/cDNA clone-Lentivirus particle (NM_138634)

Cat. No.: vGMLP003371

Pre-made Human MSMB/HPC13/IGBF Lentiviral expression plasmid for MSMB lentivirus packaging, MSMB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MSMB/HPC13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003371 Human MSMB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003371
Gene Name MSMB
Accession Number NM_138634
Gene ID 4477
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 234 bp
Gene Alias HPC13,IGBF,MSP,MSPB,PN44,PRPS,PSP,PSP-94,PSP57,PSP94
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATGTTCTCCTGGGCAGCGTTGTGATCTTTGCCACCTTCGTGACTTTATGCAATGCATCATGCTATTTCATACCTAATGAGGGAGTTCCAGGAGATTCAACCAGGATGTTTCTACACCTGTGGGTTATGACAAAGACAACTGCCAAAGAATCTTCAAGAAGGAGGACTGCAAGTATATCGTGGTGGAGAAGAAGGACCCAAAAAAGACCTGTTCTGTCAGTGAATGGATAA
ORF Protein Sequence MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRMFLHLWVMTKTTAKESSRRRTASISWWRRRTQKRPVLSVNG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T07374-Ab Anti-MSMB/ HPC13/ IGBF functional antibody
    Target Antigen GM-Tg-g-T07374-Ag MSMB protein
    ORF Viral Vector pGMLP003371 Human MSMB Lentivirus plasmid
    ORF Viral Vector vGMLP003371 Human MSMB Lentivirus particle


    Target information

    Target ID GM-T07374
    Target Name MSMB
    Gene ID 4477, 17695, 709332, 29311, 102901471, 616019, 100629874
    Gene Symbol and Synonyms beta-MSP,HPC13,IGBF,MSMB,MSP,MSPB,PIP,PN44,PRPS,PSP,PSP-94,PSP57,PSP94
    Uniprot Accession P08118
    Uniprot Entry Name MSMB_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Prostate disease
    Gene Ensembl ENSG00000263639
    Target Classification Not Available

    The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.