Human HSPE1/CPN10/EPF ORF/cDNA clone-Lentivirus plasmid (NM_002157)
Cat. No.: pGMLP003382
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HSPE1/CPN10/EPF Lentiviral expression plasmid for HSPE1 lentivirus packaging, HSPE1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HSPE1/CPN10 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003382 |
Gene Name | HSPE1 |
Accession Number | NM_002157 |
Gene ID | 3336 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 309 bp |
Gene Alias | CPN10,EPF,GROES,HSP10 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCAGGACAAGCGTTTAGAAAGTTTCTTCCACTCTTTGACCGAGTATTGGTTGAAAGGAGTGCTGCTGAAACTGTAACCAAAGGAGGCATTATGCTTCCAGAAAAATCTCAAGGAAAAGTATTGCAAGCAACAGTAGTCGCTGTTGGATCGGGTTCTAAAGGAAAGGGTGGAGAGATTCAACCAGTTAGCGTGAAAGTTGGAGATAAAGTTCTTCTCCCAGAATATGGAGGCACCAAAGTAGTTCTAGATGACAAGGATTATTTCCTATTTAGAGATGGTGACATTCTTGGAAAGTACGTAGACTGA |
ORF Protein Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T30940-Ab | Anti-HSPE1 monoclonal antibody |
Target Antigen | GM-Tg-g-T30940-Ag | HSPE1 protein |
ORF Viral Vector | pGMLP003382 | Human HSPE1 Lentivirus plasmid |
ORF Viral Vector | pGMPC001325 | Human HSPE1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP003382 | Human HSPE1 Lentivirus particle |
Target information
Target ID | GM-T30940 |
Target Name | HSPE1 |
Gene ID | 3336, 15528, 100425423, 25462, 281833 |
Gene Symbol and Synonyms | 10kDa,CPN10,EPF,GROES,HSP10,HSPE1,mt-cpn10 |
Uniprot Accession | P61604 |
Uniprot Entry Name | CH10_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000115541 |
Target Classification | Not Available |
This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.