Human HSPE1/CPN10/EPF ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002157)

Cat. No.: pGMPC001325
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HSPE1/CPN10/EPF Non-Viral expression plasmid (overexpression vector) for mouse HSPE1 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HSPE1/CPN10 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001325
Gene Name HSPE1
Accession Number NM_002157
Gene ID 3336
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 309 bp
Gene Alias CPN10,EPF,GROES,HSP10
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGACAAGCGTTTAGAAAGTTTCTTCCACTCTTTGACCGAGTATTGGTTGAAAGGAGTGCTGCTGAAACTGTAACCAAAGGAGGCATTATGCTTCCAGAAAAATCTCAAGGAAAAGTATTGCAAGCAACAGTAGTCGCTGTTGGATCGGGTTCTAAAGGAAAGGGTGGAGAGATTCAACCAGTTAGCGTGAAAGTTGGAGATAAAGTTCTTCTCCCAGAATATGGAGGCACCAAAGTAGTTCTAGATGACAAGGATTATTTCCTATTTAGAGATGGTGACATTCTTGGAAAGTACGTAGACTGA
ORF Protein Sequence MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T30940-Ab Anti-HSPE1 monoclonal antibody
    Target Antigen GM-Tg-g-T30940-Ag HSPE1 protein
    ORF Viral Vector pGMLP003382 Human HSPE1 Lentivirus plasmid
    ORF Viral Vector pGMPC001325 Human HSPE1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003382 Human HSPE1 Lentivirus particle


    Target information

    Target ID GM-T30940
    Target Name HSPE1
    Gene ID 3336, 15528, 100425423, 25462, 281833
    Gene Symbol and Synonyms 10kDa,CPN10,EPF,GROES,HSP10,HSPE1,mt-cpn10
    Uniprot Accession P61604
    Uniprot Entry Name CH10_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000115541
    Target Classification Not Available

    This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.