Human HIGD2A/RCF1b ORF/cDNA clone-Lentivirus plasmid (NM_138820)
Cat. No.: pGMLP003383
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HIGD2A/RCF1b Lentiviral expression plasmid for HIGD2A lentivirus packaging, HIGD2A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HIGD2A/RCF1b products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003383 |
Gene Name | HIGD2A |
Accession Number | NM_138820 |
Gene ID | 192286 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 321 bp |
Gene Alias | RCF1b |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGACTCCCGGCCCTGTGATTCCGGAGGTCCCCTTTGAACCATCGAAGCCTCCAGTCATTGAGGGGCTGAGCCCCACTGTTTACAGGAATCCAGAGAGTTTCAAGGAAAAGTTCGTTCGCAAGACCCGCGAGAACCCGGTGGTACCCATAGGTTGCCTGGCCACGGCGGCCGCCCTCACCTACGGCCTCTACTCCTTCCACCGGGGCAACAGCCAGCGCTCTCAGCTCATGATGCGCACCCGGATCGCCGCCCAGGGTTTCACGGTCGCAGCCATCTTGCTGGGTCTGGCTGTCACTGCTATGAAGTCTCGACCCTAA |
ORF Protein Sequence | MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0967-Ab | Anti-HIGD2A monoclonal antibody |
Target Antigen | GM-Tg-g-IP0967-Ag | HIGD2A protein |
ORF Viral Vector | pGMLP003383 | Human HIGD2A Lentivirus plasmid |
ORF Viral Vector | vGMLP003383 | Human HIGD2A Lentivirus particle |
Target information
Target ID | GM-IP0967 |
Target Name | HIGD2A |
Gene ID | 192286, 67044, 696888, 290999, 101082208, 479281, 506420, 100068903 |
Gene Symbol and Synonyms | 2010110M21Rik,HIGD2A,RCF1b,RGD1309691 |
Uniprot Accession | Q9BW72 |
Uniprot Entry Name | HIG2A_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000146066 |
Target Classification | Not Available |
The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.