Human HIGD2A/RCF1b ORF/cDNA clone-Lentivirus particle (NM_138820)

Cat. No.: vGMLP003383

Pre-made Human HIGD2A/RCF1b Lentiviral expression plasmid for HIGD2A lentivirus packaging, HIGD2A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HIGD2A/RCF1b products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003383 Human HIGD2A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003383
Gene Name HIGD2A
Accession Number NM_138820
Gene ID 192286
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 321 bp
Gene Alias RCF1b
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGACTCCCGGCCCTGTGATTCCGGAGGTCCCCTTTGAACCATCGAAGCCTCCAGTCATTGAGGGGCTGAGCCCCACTGTTTACAGGAATCCAGAGAGTTTCAAGGAAAAGTTCGTTCGCAAGACCCGCGAGAACCCGGTGGTACCCATAGGTTGCCTGGCCACGGCGGCCGCCCTCACCTACGGCCTCTACTCCTTCCACCGGGGCAACAGCCAGCGCTCTCAGCTCATGATGCGCACCCGGATCGCCGCCCAGGGTTTCACGGTCGCAGCCATCTTGCTGGGTCTGGCTGTCACTGCTATGAAGTCTCGACCCTAA
ORF Protein Sequence MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0967-Ab Anti-HIGD2A monoclonal antibody
    Target Antigen GM-Tg-g-IP0967-Ag HIGD2A protein
    ORF Viral Vector pGMLP003383 Human HIGD2A Lentivirus plasmid
    ORF Viral Vector vGMLP003383 Human HIGD2A Lentivirus particle


    Target information

    Target ID GM-IP0967
    Target Name HIGD2A
    Gene ID 192286, 67044, 696888, 290999, 101082208, 479281, 506420, 100068903
    Gene Symbol and Synonyms 2010110M21Rik,HIGD2A,RCF1b,RGD1309691
    Uniprot Accession Q9BW72
    Uniprot Entry Name HIG2A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000146066
    Target Classification Not Available

    The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.