Human DNAJC15/DNAJD1/HSD18 ORF/cDNA clone-Lentivirus plasmid (NM_013238)

Cat. No.: pGMLP003407
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DNAJC15/DNAJD1/HSD18 Lentiviral expression plasmid for DNAJC15 lentivirus packaging, DNAJC15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DNAJC15/DNAJD1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003407
Gene Name DNAJC15
Accession Number NM_013238
Gene ID 29103
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 453 bp
Gene Alias DNAJD1,HSD18,MCJ
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCCGTGGTGTCATCGCTCCAGTTGGCGAGAGTTTGCGCTACGCTGAGTACTTGCAGCCCTCGGCCAAACGGCCAGACGCCGACGTCGACCAGCAGAGACTGGTAAGAAGTTTGATAGCTGTAGGACTGGGTGTTGCAGCTCTTGCATTTGCAGGTCGCTACGCATTTCGGATCTGGAAACCTCTAGAACAAGTTATCACAGAAACTGCAAAGAAGATTTCAACTCCTAGCTTTTCATCCTACTATAAAGGAGGATTTGAACAGAAAATGAGTAGGCGAGAAGCTGGTCTTATTTTAGGTGTAAGCCCATCTGCTGGCAAGGCTAAGATTAGAACAGCTCATAGGAGAGTCATGATTTTGAATCACCCAGATAAAGGTGGATCTCCTTACGTAGCAGCCAAAATAAATGAAGCAAAAGACTTGCTAGAAACAACCACCAAACATTGA
ORF Protein Sequence MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0707-Ab Anti-DNAJC15 monoclonal antibody
    Target Antigen GM-Tg-g-IP0707-Ag DNAJC15 protein
    ORF Viral Vector pGMLP003407 Human DNAJC15 Lentivirus plasmid
    ORF Viral Vector vGMLP003407 Human DNAJC15 Lentivirus particle


    Target information

    Target ID GM-IP0707
    Target Name DNAJC15
    Gene ID 29103, 66148, 700339, 290370, 101087037, 476930, 618047, 100051263
    Gene Symbol and Synonyms 1110003P16Rik,DNAJC15,DNAJD1,HSD18,MCJ
    Uniprot Accession Q9Y5T4
    Uniprot Entry Name DJC15_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000120675
    Target Classification Not Available

    Predicted to enable ATPase activator activity. Predicted to be involved in protein import into mitochondrial matrix. Predicted to act upstream of or within several processes, including cellular response to starvation; negative regulation of mitochondrial electron transport, NADH to ubiquinone; and negative regulation of protein-containing complex assembly. Predicted to be located in mitochondrial inner membrane. Predicted to be part of PAM complex, Tim23 associated import motor. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.