Human BASP1/CAP-23/CAP23 ORF/cDNA clone-Lentivirus plasmid (NM_001271606)
Cat. No.: pGMLP003463
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human BASP1/CAP-23/CAP23 Lentiviral expression plasmid for BASP1 lentivirus packaging, BASP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
BASP1/CAP-23 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003463 |
Gene Name | BASP1 |
Accession Number | NM_001271606 |
Gene ID | 10409 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 684 bp |
Gene Alias | CAP-23,CAP23,NAP-22,NAP22 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGAGGCAAGCTCAGCAAGAAGAAGAAGGGCTACAATGTGAACGACGAGAAAGCCAAGGAGAAAGACAAGAAGGCCGAGGGCGCGGCGACGGAAGAGGAGGGGACCCCGAAGGAGAGTGAGCCCCAGGCGGCCGCAGAGCCCGCCGAGGCCAAGGAGGGCAAGGAGAAGCCCGACCAGGACGCCGAGGGCAAGGCCGAGGAGAAGGAGGGCGAGAAGGACGCGGCGGCTGCCAAGGAGGAGGCCCCGAAGGCGGAGCCCGAGAAGACGGAGGGCGCGGCAGAGGCCAAGGCTGAGCCCCCGAAGGCGCCCGAGCAGGAGCAGGCGGCCCCCGGCCCCGCTGCGGGCGGCGAGGCCCCCAAAGCTGCTGAGGCCGCCGCGGCCCCGGCCGAGAGCGCGGCCCCTGCCGCCGGGGAGGAGCCCAGCAAGGAGGAAGGGGAACCCAAAAAGACTGAGGCGCCCGCAGCTCCTGCCGCCCAGGAGACCAAAAGTGACGGGGCCCCAGCTTCAGACTCAAAACCCGGCAGCTCGGAGGCTGCCCCCTCTTCCAAGGAGACCCCCGCAGCCACGGAAGCGCCTAGTTCCACACCCAAGGCCCAGGGCCCCGCAGCCTCTGCAGAAGAGCCCAAGCCGGTGGAGGCCCCGGCAGCTAATTCCGACCAAACCGTAACCGTGAAAGAGTGA |
ORF Protein Sequence | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2017-Ab | Anti-BASP1/ CAP-23/ CAP23 monoclonal antibody |
Target Antigen | GM-Tg-g-MP2017-Ag | BASP1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003463 | Human BASP1 Lentivirus plasmid |
ORF Viral Vector | vGMLP003463 | Human BASP1 Lentivirus particle |
Target information
Target ID | GM-MP2017 |
Target Name | BASP1 |
Gene ID | 10409, 70350, 700114, 64160, 101088724, 612722, 286842, 100069914 |
Gene Symbol and Synonyms | 2610024P12Rik,BASP1,CAP-23,CAP23,Ckap3,NAP-22,NAP22 |
Uniprot Accession | P80723 |
Uniprot Entry Name | BASP1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000176788 |
Target Classification | Not Available |
This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.