Human KLK10/NES1/PRSSL1 ORF/cDNA clone-Lentivirus plasmid (NM_001077500)

Cat. No.: pGMLP003500
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLK10/NES1/PRSSL1 Lentiviral expression plasmid for KLK10 lentivirus packaging, KLK10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KLK10/NES1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $507.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003500
Gene Name KLK10
Accession Number NM_001077500
Gene ID 5655
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 831 bp
Gene Alias NES1,PRSSL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGCTCCGCACCTCCACCTCTCCGCCGCCTCTGGCGCCCGGGCTCTGGCGAAGCTGCTGCCGCTGCTGATGGCGCAACTCTGGGCCGCAGAGGCGGCGCTGCTCCCCCAAAACGACACGCGCTTGGACCCCGAAGCCTATGGCTCCCCGTGCGCGCGCGGCTCGCAGCCCTGGCAGGTCTCGCTCTTCAACGGCCTCTCGTTCCACTGCGCGGGTGTCCTGGTGGACCAGAGTTGGGTGCTGACGGCCGCGCACTGCGGAAACAAGCCACTGTGGGCTCGAGTAGGGGATGACCACCTGCTGCTTCTTCAGGGAGAGCAGCTCCGCCGGACCACTCGCTCTGTTGTCCATCCCAAGTACCACCAGGGCTCAGGCCCCATCCTGCCAAGGCGAACGGATGAGCACGATCTCATGTTGCTGAAGCTGGCCAGGCCCGTAGTGCTGGGGCCCCGCGTCCGGGCCCTGCAGCTTCCCTACCGCTGTGCTCAGCCCGGAGACCAGTGCCAGGTTGCTGGCTGGGGCACCACGGCCGCCCGGAGAGTGAAGTACAACAAGGGCCTGACCTGCTCCAGCATCACTATCCTGAGCCCTAAAGAGTGTGAGGTCTTCTACCCTGGCGTGGTCACCAACAACATGATATGTGCTGGACTGGACCGGGGCCAGGACCCTTGCCAGAGTGACTCTGGAGGCCCCCTGGTCTGTGACGAGACCCTCCAAGGCATCCTCTCGTGGGGTGTTTACCCCTGTGGCTCTGCCCAGCATCCAGCTGTCTACACCCAGATCTGCAAATACATGTCCTGGATCAATAAAGTCATACGCTCCAACTGA
ORF Protein Sequence MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1047-Ab Anti-KLK10/ NES1/ PRSSL1 functional antibody
    Target Antigen GM-Tg-g-SE1047-Ag KLK10 protein
    ORF Viral Vector pGMLP003500 Human KLK10 Lentivirus plasmid
    ORF Viral Vector pGMLP004037 Human KLK10 Lentivirus plasmid
    ORF Viral Vector vGMLP003500 Human KLK10 Lentivirus particle
    ORF Viral Vector vGMLP004037 Human KLK10 Lentivirus particle


    Target information

    Target ID GM-SE1047
    Target Name KLK10
    Gene ID 5655, 69540, 106994828, 292850, 101088633, 484351, 526736, 100146904
    Gene Symbol and Synonyms 2300002A13Rik,KLK10,Klnj,NES1,PRSSL1
    Uniprot Accession O43240
    Uniprot Entry Name KLK10_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000129451
    Target Classification Tumor-associated antigen (TAA)

    Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.