Human AQP9/AQP-9/HsT17287 ORF/cDNA clone-Lentivirus plasmid (NM_020980)
Cat. No.: pGMLP003518
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human AQP9/AQP-9/HsT17287 Lentiviral expression plasmid for AQP9 lentivirus packaging, AQP9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
AQP9/AQP-9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003518 |
Gene Name | AQP9 |
Accession Number | NM_020980 |
Gene ID | 366 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 888 bp |
Gene Alias | AQP-9,HsT17287,SSC1,T17287 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGCCTGAGGGAGCAGAAAAGGGAAAAAGCTTCAAGCAGAGACTGGTCTTGAAGAGCAGCTTAGCGAAAGAAACCCTCTCTGAGTTCTTGGGCACGTTCATCTTGATTGTCCTTGGATGTGGCTGTGTTGCCCAAGCTATTCTCAGTCGAGGACGTTTTGGAGGGGTCATCACTATCAATGTTGGATTTTCAATGGCAGTTGCAATGGCCATTTATGTGGCTGGCGGTGTCTCTGGTGGTCACATCAACCCAGCTGTGTCTTTAGCAATGTGTCTCTTTGGACGGATGAAATGGTTCAAATTGCCATTTTATGTGGGAGCCCAGTTCTTGGGAGCCTTTGTGGGGGCTGCAACCGTCTTTGGCATTTACTATGATGGACTTATGTCCTTTGCTGGTGGAAAACTGCTGATCGTGGGAGAAAATGCAACAGCACACATTTTTGCAACATACCCAGCTCCGTATCTATCTCTGGCGAACGCATTTGCAGATCAAGTGGTGGCCACCATGATACTCCTCATAATCGTCTTTGCCATCTTTGACTCCAGAAACTTGGGAGCCCCCAGAGGCCTAGAGCCCATTGCCATCGGCCTCCTGATTATTGTCATTGCTTCCTCCCTGGGACTGAACAGTGGCTGTGCCATGAACCCAGCTCGAGACCTGAGTCCCAGACTTTTCACTGCCTTGGCAGGCTGGGGGTTTGAAGTCTTCAGAGCTGGAAACAACTTCTGGTGGATTCCTGTAGTGGGCCCTTTGGTTGGTGCTGTCATTGGAGGCCTCATCTATGTTCTTGTCATTGAAATCCACCATCCAGAGCCTGACTCAGTCTTTAAGACAGAACAATCTGAGGACAAACCAGAGAAATATGAACTCAGTGTCATCATGTAG |
ORF Protein Sequence | MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T79566-Ab | Anti-AQP9/ AQP-9/ HsT17287 monoclonal antibody |
Target Antigen | GM-Tg-g-T79566-Ag | AQP9 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003518 | Human AQP9 Lentivirus plasmid |
ORF Viral Vector | pGMPC000381 | Human AQP9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC004790 | Human AQP9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP003518 | Human AQP9 Lentivirus particle |
Target information
Target ID | GM-T79566 |
Target Name | AQP9 |
Gene ID | 366, 64008, 700743, 65054, 101082662, 487576, 516762, 100054508 |
Gene Symbol and Synonyms | 1700020I22Rik,AQP-9,AQP9,HsT17287,SSC1,T17287 |
Uniprot Accession | O43315 |
Uniprot Entry Name | AQP9_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000103569 |
Target Classification | Not Available |
The aquaporins are a family of water-selective membrane channels. This gene encodes a member of a subset of aquaporins called the aquaglyceroporins. This protein allows passage of a broad range of noncharged solutes and also stimulates urea transport and osmotic water permeability. This protein may also facilitate the uptake of glycerol in hepatic tissue . The encoded protein may also play a role in specialized leukocyte functions such as immunological response and bactericidal activity. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.