Human SYP/MRX96/MRXSYP ORF/cDNA clone-Lentivirus plasmid (NM_003179)

Cat. No.: pGMLP003530
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SYP/MRX96/MRXSYP Lentiviral expression plasmid for SYP lentivirus packaging, SYP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SYP/MRX96 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $535.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003530
Gene Name SYP
Accession Number NM_003179
Gene ID 6855
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 942 bp
Gene Alias MRX96,MRXSYP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCTGCTGGCGGACATGGACGTGGTGAATCAGCTGGTGGCTGGGGGTCAGTTCCGGGTGGTCAAGGAGCCCCTCGGCTTTGTGAAGGTGCTGCAATGGGTCTTCGCCATCTTCGCCTTTGCCACATGCGGCAGCTACAGTGGGGAGCTCCAGCTGAGCGTGGATTGTGCCAACAAGACCGAGAGTGACCTCAGCATCGAGGTCGAGTTCGAGTACCCCTTCAGGCTGCACCAAGTGTACTTTGATGCACCCACCTGCCGAGGGGGCACCACCAAGGTCTTCTTAGTTGGGGACTACTCCTCGTCAGCCGAATTCTTTGTCACCGTGGCCGTGTTTGCCTTCCTCTACTCCATGGGGGCTCTGGCCACCTACATCTTCCTGCAGAACAAGTACCGAGAGAATAACAAAGGGCCCATGCTGGACTTTCTGGCCACGGCTGTGTTCGCCTTCATGTGGCTAGTTAGCTCATCGGCATGGGCCAAGGGGCTGTCAGATGTGAAGATGGCCACAGACCCAGAGAACATTATCAAGGAGATGCCTGTCTGCCGCCAGACAGGGAACACATGCAAGGAGCTGAGAGACCCTGTGACCTCGGGACTCAACACCTCGGTGGTGTTCGGCTTCCTGAACCTGGTGCTCTGGGTCGGCAACCTGTGGTTCGTGTTTAAGGAGACAGGCTGGGCCGCCCCGTTCCTGCGCGCGCCTCCCGGCGCCCCCGAGAAACAACCGGCACCCGGGGACGCCTACGGCGATGCAGGCTACGGGCAGGGCCCCGGCGGGTACGGGCCCCAGGATTCCTACGGGCCTCAGGGCGGCTACCAGCCTGACTATGGTCAACCAGCCGGCAGCGGTGGCAGTGGCTACGGGCCTCAGGGCGACTATGGGCAGCAAGGCTACGGCCCGCAGGGTGCACCCACCTCCTTCTCCAATCAGATGTAG
ORF Protein Sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1872-Ab Anti-SYP monoclonal antibody
    Target Antigen GM-Tg-g-IP1872-Ag SYP protein
    ORF Viral Vector pGMLP003530 Human SYP Lentivirus plasmid
    ORF Viral Vector vGMLP003530 Human SYP Lentivirus particle


    Target information

    Target ID GM-IP1872
    Target Name SYP
    Gene ID 6855, 20977, 715739, 24804, 101084343, 612557, 280937, 100062804
    Gene Symbol and Synonyms A230093K24Rik,MRX96,MRXSYP,p38,Syn,SYP,Syp1,XLID96
    Uniprot Accession P08247
    Uniprot Entry Name SYPH_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Desmoplastic small round cell tumor (DSRCT), Schizophrenia
    Gene Ensembl ENSG00000102003
    Target Classification Not Available

    This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.