Human TACR2/NK2R/NKNAR ORF/cDNA clone-Lentivirus plasmid (NM_001057)

Cat. No.: pGMLP003644
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TACR2/NK2R/NKNAR Lentiviral expression plasmid for TACR2 lentivirus packaging, TACR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TACR2/NK2R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $635.16
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003644
Gene Name TACR2
Accession Number NM_001057
Gene ID 6865
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1197 bp
Gene Alias NK2R,NKNAR,SKR,TAC2R
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGACCTGTGACATTGTGACTGAAGCCAATATCTCATCTGGCCCTGAGAGCAACACCACGGGCATCACAGCCTTCTCCATGCCCAGCTGGCAACTGGCACTGTGGGCCACAGCCTACCTGGCCCTGGTGCTGGTGGCCGTGACGGGTAATGCCATCGTCATCTGGATCATCCTGGCCCATCGGAGGATGCGCACAGTCACCAACTACTTCATCGTCAATCTGGCGCTGGCTGACCTCTGCATGGCTGCCTTCAATGCCGCCTTCAACTTTGTCTATGCCAGCCACAACATCTGGTACTTTGGCCGTGCCTTCTGCTACTTCCAGAACCTCTTCCCCATCACAGCCATGTTTGTCAGCATCTACTCCATGACCGCCATTGCTGCCGACAGGTACATGGCCATCGTCCACCCCTTCCAGCCTCGGCTTTCAGCTCCCAGCACCAAGGCGGTTATTGCTGGCATCTGGCTGGTGGCTCTCGCCCTGGCCTCCCCTCAGTGCTTCTACTCCACCGTCACCATGGACCAGGGTGCCACCAAGTGCGTGGTGGCCTGGCCCGAAGACAGCGGGGGCAAGACGCTCCTCCTGTACCACCTCGTGGTGATCGCCCTCATCTACTTCCTGCCGCTCGCGGTGATGTTTGTAGCCTACAGCGTCATCGGCCTCACGCTCTGGAGGCGCGCAGTGCCCGGACATCAGGCGCACGGTGCCAACCTGCGCCACCTGCAGGCCATGAAGAAGTTTGTGAAGACCATGGTGCTGGTGGTGCTGACGTTTGCCATCTGCTGGCTGCCCTACCACCTCTACTTCATCCTGGGCAGCTTCCAGGAGGACATCTACTGCCACAAGTTCATCCAGCAAGTCTACCTGGCACTCTTCTGGTTGGCCATGAGCTCTACCATGTACAATCCCATCATCTACTGCTGTCTCAACCACAGGTTTCGCTCTGGATTCCGGCTTGCCTTCCGCTGCTGCCCATGGGTCACACCCACCAAGGAAGATAAGCTCGAGCTGACTCCCACGACCTCCCTCTCCACGAGAGTCAACAGGTGTCACACTAAGGAGACTTTGTTCATGGCTGGGGACACAGCCCCCTCCGAGGCTACCAGTGGGGAGGCGGGGCGTCCCCAGGATGGATCAGGGCTATGGTTTGGGTATGGTTTGCTTGCCCCCACCAAAACTCATGTTGAAATTTGA
ORF Protein Sequence MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T52790-Ab Anti-NK2R/ TACR2/ NKNAR monoclonal antibody
    Target Antigen GM-Tg-g-T52790-Ag TACR2 VLP (virus-like particle)
    ORF Viral Vector pGMLP003644 Human TACR2 Lentivirus plasmid
    ORF Viral Vector vGMLP003644 Human TACR2 Lentivirus particle


    Target information

    Target ID GM-T52790
    Target Name TACR2
    Gene ID 6865, 21337, 711842, 25007, 101094541, 489020, 282088, 100034168
    Gene Symbol and Synonyms NK-2,NK-2R,NK2R,NKNAR,SKR,TAC2R,TACR2
    Uniprot Accession P21452
    Uniprot Entry Name NK2R_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000075073
    Target Classification GPCR

    This gene belongs to a family of genes that function as receptors for tachykinins.  Receptor affinities are specified by variations in the 5'-end of the sequence.  The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions.  This gene encodes the receptor for the tachykinin neuropeptide substance K, also referred to as neurokinin A. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.