Human TACR2/NK2R/NKNAR ORF/cDNA clone-Lentivirus plasmid (NM_001057)
Cat. No.: pGMLP003644
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TACR2/NK2R/NKNAR Lentiviral expression plasmid for TACR2 lentivirus packaging, TACR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TACR2/NK2R products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003644 |
Gene Name | TACR2 |
Accession Number | NM_001057 |
Gene ID | 6865 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1197 bp |
Gene Alias | NK2R,NKNAR,SKR,TAC2R |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGGACCTGTGACATTGTGACTGAAGCCAATATCTCATCTGGCCCTGAGAGCAACACCACGGGCATCACAGCCTTCTCCATGCCCAGCTGGCAACTGGCACTGTGGGCCACAGCCTACCTGGCCCTGGTGCTGGTGGCCGTGACGGGTAATGCCATCGTCATCTGGATCATCCTGGCCCATCGGAGGATGCGCACAGTCACCAACTACTTCATCGTCAATCTGGCGCTGGCTGACCTCTGCATGGCTGCCTTCAATGCCGCCTTCAACTTTGTCTATGCCAGCCACAACATCTGGTACTTTGGCCGTGCCTTCTGCTACTTCCAGAACCTCTTCCCCATCACAGCCATGTTTGTCAGCATCTACTCCATGACCGCCATTGCTGCCGACAGGTACATGGCCATCGTCCACCCCTTCCAGCCTCGGCTTTCAGCTCCCAGCACCAAGGCGGTTATTGCTGGCATCTGGCTGGTGGCTCTCGCCCTGGCCTCCCCTCAGTGCTTCTACTCCACCGTCACCATGGACCAGGGTGCCACCAAGTGCGTGGTGGCCTGGCCCGAAGACAGCGGGGGCAAGACGCTCCTCCTGTACCACCTCGTGGTGATCGCCCTCATCTACTTCCTGCCGCTCGCGGTGATGTTTGTAGCCTACAGCGTCATCGGCCTCACGCTCTGGAGGCGCGCAGTGCCCGGACATCAGGCGCACGGTGCCAACCTGCGCCACCTGCAGGCCATGAAGAAGTTTGTGAAGACCATGGTGCTGGTGGTGCTGACGTTTGCCATCTGCTGGCTGCCCTACCACCTCTACTTCATCCTGGGCAGCTTCCAGGAGGACATCTACTGCCACAAGTTCATCCAGCAAGTCTACCTGGCACTCTTCTGGTTGGCCATGAGCTCTACCATGTACAATCCCATCATCTACTGCTGTCTCAACCACAGGTTTCGCTCTGGATTCCGGCTTGCCTTCCGCTGCTGCCCATGGGTCACACCCACCAAGGAAGATAAGCTCGAGCTGACTCCCACGACCTCCCTCTCCACGAGAGTCAACAGGTGTCACACTAAGGAGACTTTGTTCATGGCTGGGGACACAGCCCCCTCCGAGGCTACCAGTGGGGAGGCGGGGCGTCCCCAGGATGGATCAGGGCTATGGTTTGGGTATGGTTTGCTTGCCCCCACCAAAACTCATGTTGAAATTTGA |
ORF Protein Sequence | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T52790-Ab | Anti-NK2R/ TACR2/ NKNAR monoclonal antibody |
Target Antigen | GM-Tg-g-T52790-Ag | TACR2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003644 | Human TACR2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003644 | Human TACR2 Lentivirus particle |
Target information
Target ID | GM-T52790 |
Target Name | TACR2 |
Gene ID | 6865, 21337, 711842, 25007, 101094541, 489020, 282088, 100034168 |
Gene Symbol and Synonyms | NK-2,NK-2R,NK2R,NKNAR,SKR,TAC2R,TACR2 |
Uniprot Accession | P21452 |
Uniprot Entry Name | NK2R_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000075073 |
Target Classification | GPCR |
This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neuropeptide substance K, also referred to as neurokinin A. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.