Human MCHR1/GPR24/MCH-1R ORF/cDNA clone-Lentivirus plasmid (NM_005297)

Cat. No.: pGMLP003679
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MCHR1/GPR24/MCH-1R Lentiviral expression plasmid for MCHR1 lentivirus packaging, MCHR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MCHR1/GPR24 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $655.32
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003679
Gene Name MCHR1
Accession Number NM_005297
Gene ID 2847
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1269 bp
Gene Alias GPR24,MCH-1R,MCH1R,SLC-1,SLC1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCTGGAAGCCTCGCTGCTGCCCACTGGTCCCAACGCCAGCAACACCTCTGATGGCCCCGATAACCTCACTTCGGCAGGATCACCTCCTCGCACGGGGAGCATCTCCTACATCAACATCATCATGCCTTCGGTGTTCGGCACCATCTGCCTCCTGGGCATCATCGGGAACTCCACGGTCATCTTCGCGGTCGTGAAGAAGTCCAAGCTGCACTGGTGCAACAACGTCCCCGACATCTTCATCATCAACCTCTCGGTAGTAGATCTCCTCTTTCTCCTGGGCATGCCCTTCATGATCCACCAGCTCATGGGCAATGGGGTGTGGCACTTTGGGGAGACCATGTGCACCCTCATCACGGCCATGGATGCCAATAGTCAGTTCACCAGCACCTACATCCTGACCGCCATGGCCATTGACCGCTACCTGGCCACTGTCCACCCCATCTCTTCCACGAAGTTCCGGAAGCCCTCTGTGGCCACCCTGGTGATCTGCCTCCTGTGGGCCCTCTCCTTCATCAGCATCACCCCTGTGTGGCTGTATGCCAGACTCATCCCCTTCCCAGGAGGTGCAGTGGGCTGCGGCATACGCCTGCCCAACCCAGACACTGACCTCTACTGGTTCACCCTGTACCAGTTTTTCCTGGCCTTTGCCCTGCCTTTTGTGGTCATCACAGCCGCATACGTGAGGATCCTGCAGCGCATGACGTCCTCAGTGGCCCCCGCCTCCCAGCGCAGCATCCGGCTGCGGACAAAGAGGGTGACCCGCACAGCCATCGCCATCTGTCTGGTCTTCTTTGTGTGCTGGGCACCCTACTATGTGCTACAGCTGACCCAGTTGTCCATCAGCCGCCCGACCCTCACCTTTGTCTACTTATACAATGCGGCCATCAGCTTGGGCTATGCCAACAGCTGCCTCAACCCCTTTGTGTACATCGTGCTCTGTGAGACGTTCCGCAAACGCTTGGTCCTGTCGGTGAAGCCTGCAGCCCAGGGGCAGCTTCGCGCTGTCAGCAACGCTCAGACGGCTGACGAGGAGAGGACAGAAAGCAAAGGCACCTGA
ORF Protein Sequence MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T09572-Ab Anti-MCHR1/ GPR24/ MCH-1R monoclonal antibody
    Target Antigen GM-Tg-g-T09572-Ag MCHR1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003679 Human MCHR1 Lentivirus plasmid
    ORF Viral Vector vGMLP003679 Human MCHR1 Lentivirus particle


    Target information

    Target ID GM-T09572
    Target Name MCHR1
    Gene ID 2847, 207911, 574232, 83567, 101086323, 403563, 540119, 100055460
    Gene Symbol and Synonyms GPR24,MCH-1R,MCH1R,MCHR1,SLC-1,SLC1
    Uniprot Accession Q99705
    Uniprot Entry Name MCHR1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000128285
    Target Classification GPCR

    The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.