Human SUMO4/dJ281H8.4/IDDM5 ORF/cDNA clone-Lentivirus plasmid (NM_001002255)
Cat. No.: pGMLP003800
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SUMO4/dJ281H8.4/IDDM5 Lentiviral expression plasmid for SUMO4 lentivirus packaging, SUMO4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SUMO4/dJ281H8.4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003800 |
Gene Name | SUMO4 |
Accession Number | NM_001002255 |
Gene ID | 387082 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 288 bp |
Gene Alias | dJ281H8.4,IDDM5,SMT3H4,SUMO-4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCAACGAAAAGCCCACAGAAGAAGTCAAGACTGAGAACAACAATCATATTAATTTGAAGGTGGCGGGACAGGATGGTTCTGTGGTGCAGTTTAAGATTAAGAGGCAGACACCACTTAGTAAACTAATGAAAGCCTATTGTGAACCACGGGGATTGTCAGTGAAGCAGATCAGATTCCGATTTGGTGGGCAACCAATCAGTGGAACAGACAAACCTGCACAGTTGGAAATGGAAGATGAAGATACAATTGATGTGTTTCAACAGCCTACGGGAGGTGTCTACTGA |
ORF Protein Sequence | MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA177-Ab | Anti-SUMO4 monoclonal antibody |
Target Antigen | GM-Tg-g-TA177-Ag | SUMO4 protein |
ORF Viral Vector | pGMLP003800 | Human SUMO4 Lentivirus plasmid |
ORF Viral Vector | vGMLP003800 | Human SUMO4 Lentivirus particle |
Target information
Target ID | GM-TA177 |
Target Name | SUMO4 |
Gene ID | 387082 |
Gene Symbol and Synonyms | dJ281H8.4,IDDM5,SMT3H4,SUMO-4,SUMO4 |
Uniprot Accession | Q6EEV6 |
Uniprot Entry Name | SUMO4_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000177688 |
Target Classification | Not Available |
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.