Human SUMO4/dJ281H8.4/IDDM5 ORF/cDNA clone-Lentivirus particle (NM_001002255)

Cat. No.: vGMLP003800

Pre-made Human SUMO4/dJ281H8.4/IDDM5 Lentiviral expression plasmid for SUMO4 lentivirus packaging, SUMO4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SUMO4/dJ281H8.4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003800 Human SUMO4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003800
Gene Name SUMO4
Accession Number NM_001002255
Gene ID 387082
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 288 bp
Gene Alias dJ281H8.4,IDDM5,SMT3H4,SUMO-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAACGAAAAGCCCACAGAAGAAGTCAAGACTGAGAACAACAATCATATTAATTTGAAGGTGGCGGGACAGGATGGTTCTGTGGTGCAGTTTAAGATTAAGAGGCAGACACCACTTAGTAAACTAATGAAAGCCTATTGTGAACCACGGGGATTGTCAGTGAAGCAGATCAGATTCCGATTTGGTGGGCAACCAATCAGTGGAACAGACAAACCTGCACAGTTGGAAATGGAAGATGAAGATACAATTGATGTGTTTCAACAGCCTACGGGAGGTGTCTACTGA
ORF Protein Sequence MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA177-Ab Anti-SUMO4 monoclonal antibody
    Target Antigen GM-Tg-g-TA177-Ag SUMO4 protein
    ORF Viral Vector pGMLP003800 Human SUMO4 Lentivirus plasmid
    ORF Viral Vector vGMLP003800 Human SUMO4 Lentivirus particle


    Target information

    Target ID GM-TA177
    Target Name SUMO4
    Gene ID 387082
    Gene Symbol and Synonyms dJ281H8.4,IDDM5,SMT3H4,SUMO-4,SUMO4
    Uniprot Accession Q6EEV6
    Uniprot Entry Name SUMO4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000177688
    Target Classification Not Available

    This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.