Human SUCNR1/GPR91 ORF/cDNA clone-Lentivirus plasmid (NM_033050)

Cat. No.: pGMLP003844
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SUCNR1/GPR91 Lentiviral expression plasmid for SUCNR1 lentivirus packaging, SUCNR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SUCNR1/GPR91 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $581.4
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003844
Gene Name SUCNR1
Accession Number NM_033050
Gene ID 56670
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1005 bp
Gene Alias GPR91
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGGGGATCATGGCATGGAATGCAACTTGCAAAAACTGGCTGGCAGCAGAGGCTGCCCTGGAAAAGTACTACCTTTCCATTTTTTATGGGATTGAGTTCGTTGTGGGAGTCCTTGGAAATACCATTGTTGTTTACGGCTACATCTTCTCTCTGAAGAACTGGAACAGCAGTAATATTTATCTCTTTAACCTCTCTGTCTCTGACTTAGCTTTTCTGTGCACCCTCCCCATGCTGATAAGGAGTTATGCCAATGGAAACTGGATATATGGAGACGTGCTCTGCATAAGCAACCGATATGTGCTTCATGCCAACCTCTATACCAGCATTCTCTTTCTCACTTTTATCAGCATAGATCGATACTTGATAATTAAGTATCCTTTCCGAGAACACCTTCTGCAAAAGAAAGAGTTTGCTATTTTAATCTCCTTGGCCATTTGGGTTTTAGTAACCTTAGAGTTACTACCCATACTTCCCCTTATAAATCCTGTTATAACTGACAATGGCACCACCTGTAATGATTTTGCAAGTTCTGGAGACCCCAACTACAACCTCATTTACAGCATGTGTCTAACACTGTTGGGGTTCCTTATTCCTCTTTTTGTGATGTGTTTCTTTTATTACAAGATTGCTCTCTTCCTAAAGCAGAGGAATAGGCAGGTTGCTACTGCTCTGCCCCTTGAAAAGCCTCTCAACTTGGTCATCATGGCAGTGGTAATCTTCTCTGTGCTTTTTACACCCTATCACGTCATGCGGAATGTGAGGATCGCTTCACGCCTGGGGAGTTGGAAGCAGTATCAGTGCACTCAGGTCGTCATCAACTCCTTTTACATTGTGACACGGCCTTTGGCCTTTCTGAACAGTGTCATCAACCCTGTCTTCTATTTTCTTTTGGGAGATCACTTCAGGGACATGCTGATGAATCAACTGAGACACAACTTCAAATCCCTTACATCCTTTAGCAGATGGGCTCATGAACTCCTACTTTCATTCAGAGAAAAGTGA
ORF Protein Sequence MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T70633-Ab Anti-SUCR1/ SUCNR1/ GPR91 monoclonal antibody
    Target Antigen GM-Tg-g-T70633-Ag SUCNR1 VLP (virus-like particle)
    ORF Viral Vector pGMLP003844 Human SUCNR1 Lentivirus plasmid
    ORF Viral Vector pGMAD000984 Human SUCNR1 Adenovirus plasmid
    ORF Viral Vector vGMLP003844 Human SUCNR1 Lentivirus particle
    ORF Viral Vector vGMAD000984 Human SUCNR1 Adenovirus particle


    Target information

    Target ID GM-T70633
    Target Name SUCNR1
    Gene ID 56670, 84112, 711776, 408199, 101096096, 485719, 539622, 100056372
    Gene Symbol and Synonyms GPR91,SUCNR1
    Uniprot Accession Q9BXA5
    Uniprot Entry Name SUCR1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000198829
    Target Classification GPCR

    This gene encodes a G-protein-coupled receptor for succinate, an intermediate molecule of the citric acid cycle. It is involved in the promotion of hematopoietic progenitor cell development, and it has a potential role in renovascular hypertension which has known correlations to renal failure, diabetes and atherosclerosis. [provided by RefSeq, Oct 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.