Human SUCNR1/GPR91 ORF/cDNA clone-Lentivirus plasmid (NM_033050)
Cat. No.: pGMLP003844
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SUCNR1/GPR91 Lentiviral expression plasmid for SUCNR1 lentivirus packaging, SUCNR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SUCNR1/GPR91 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003844 |
Gene Name | SUCNR1 |
Accession Number | NM_033050 |
Gene ID | 56670 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1005 bp |
Gene Alias | GPR91 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGGGGATCATGGCATGGAATGCAACTTGCAAAAACTGGCTGGCAGCAGAGGCTGCCCTGGAAAAGTACTACCTTTCCATTTTTTATGGGATTGAGTTCGTTGTGGGAGTCCTTGGAAATACCATTGTTGTTTACGGCTACATCTTCTCTCTGAAGAACTGGAACAGCAGTAATATTTATCTCTTTAACCTCTCTGTCTCTGACTTAGCTTTTCTGTGCACCCTCCCCATGCTGATAAGGAGTTATGCCAATGGAAACTGGATATATGGAGACGTGCTCTGCATAAGCAACCGATATGTGCTTCATGCCAACCTCTATACCAGCATTCTCTTTCTCACTTTTATCAGCATAGATCGATACTTGATAATTAAGTATCCTTTCCGAGAACACCTTCTGCAAAAGAAAGAGTTTGCTATTTTAATCTCCTTGGCCATTTGGGTTTTAGTAACCTTAGAGTTACTACCCATACTTCCCCTTATAAATCCTGTTATAACTGACAATGGCACCACCTGTAATGATTTTGCAAGTTCTGGAGACCCCAACTACAACCTCATTTACAGCATGTGTCTAACACTGTTGGGGTTCCTTATTCCTCTTTTTGTGATGTGTTTCTTTTATTACAAGATTGCTCTCTTCCTAAAGCAGAGGAATAGGCAGGTTGCTACTGCTCTGCCCCTTGAAAAGCCTCTCAACTTGGTCATCATGGCAGTGGTAATCTTCTCTGTGCTTTTTACACCCTATCACGTCATGCGGAATGTGAGGATCGCTTCACGCCTGGGGAGTTGGAAGCAGTATCAGTGCACTCAGGTCGTCATCAACTCCTTTTACATTGTGACACGGCCTTTGGCCTTTCTGAACAGTGTCATCAACCCTGTCTTCTATTTTCTTTTGGGAGATCACTTCAGGGACATGCTGATGAATCAACTGAGACACAACTTCAAATCCCTTACATCCTTTAGCAGATGGGCTCATGAACTCCTACTTTCATTCAGAGAAAAGTGA |
ORF Protein Sequence | MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T70633-Ab | Anti-SUCR1/ SUCNR1/ GPR91 monoclonal antibody |
Target Antigen | GM-Tg-g-T70633-Ag | SUCNR1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003844 | Human SUCNR1 Lentivirus plasmid |
ORF Viral Vector | pGMAD000984 | Human SUCNR1 Adenovirus plasmid |
ORF Viral Vector | vGMLP003844 | Human SUCNR1 Lentivirus particle |
ORF Viral Vector | vGMAD000984 | Human SUCNR1 Adenovirus particle |
Target information
Target ID | GM-T70633 |
Target Name | SUCNR1 |
Gene ID | 56670, 84112, 711776, 408199, 101096096, 485719, 539622, 100056372 |
Gene Symbol and Synonyms | GPR91,SUCNR1 |
Uniprot Accession | Q9BXA5 |
Uniprot Entry Name | SUCR1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000198829 |
Target Classification | GPCR |
This gene encodes a G-protein-coupled receptor for succinate, an intermediate molecule of the citric acid cycle. It is involved in the promotion of hematopoietic progenitor cell development, and it has a potential role in renovascular hypertension which has known correlations to renal failure, diabetes and atherosclerosis. [provided by RefSeq, Oct 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.