Human DFFA/DFF-45/DFF1 ORF/cDNA clone-Lentivirus plasmid (BC007721)
Cat. No.: pGMLP003878
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DFFA/DFF-45/DFF1 Lentiviral expression plasmid for DFFA lentivirus packaging, DFFA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DFFA/DFF-45 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003878 |
Gene Name | DFFA |
Accession Number | BC007721 |
Gene ID | 1676 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 996 bp |
Gene Alias | DFF-45,DFF1,ICAD |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGGTGACCGGGGACGCCGGGGTACCAGAATCTGGCGAGATCCGGACTCTAAAGCCGTGTCTGCTGCGCCGCAACTACAGCCGCGAACAGCACGGCGTGGCCGCCTCCTGCCTCGAAGACCTGAGGAGCAAGGCCTGTGACATTCTGGCCATTGATAAGTCCCTGACACCAGTCACCCTGGTCCTGGCAGAGGATGGCACCATAGTGGATGATGACGATTACTTTCTGTGTCTACCTTCCAATACTAAGTTTGTGGCATTGGCTAGTAATGAGAAATGGGCATACAACAATTCAGATGGAGGTACAGCTTGGATTTCCCAAGAGTCCTTTGATGTAGATGAAACAGACAGCGGGGCAGGGTTGAAGTGGAAGAATGTGGCCAGGCAGCTGAAAGAAGATCTGTCCAGCATCATCCTCCTATCAGAGGAGGACCTCCAGATGCTTGTTGACGCTCCCTGCTCAGACCTGGCTCAGGAACTACGTCAGAGTTGTGCCACCGTCCAGCGGCTGCAGCACACACTCCAACAGGTGCTTGACCAAAGAGAGGAAGTGCGTCAGTCCAAGCAGCTCCTGCAGCTGTACCTCCAGGCTTTGGAGAAAGAGGGCAGCCTCTTGTCAAAGCAGGAAGAGTCCAAAGCTGCCTTTGGTGAGGAGGTGGATGCAGTAGACACGGGTATCAGCAGAGAGACCTCCTCGGACGTTGCGCTGGCGAGCCACATCCTTACTGCACTGAGGGAGAAGCAGGCTCCAGAGCTGAGCTTATCTAGTCAGGATTTGGAGTTGGTTACCAAGGAAGACCCCAAAGCACTGGCTGTTGCCTTGAACTGGGACATAAAGAAGACGGAGACTGTTCAGGAGGCCTGTGAGTGGGAGCTCGCCCTGCGCCTGCAGCAGACGCAGAGCTTGCATTCTCTCCGGAGCATCTCAGCAAGCAAGGCCTCACCACCTGGTGACCTGCAGAATCCTAAGCGAGCCAGACAGGATCCCACATAG |
ORF Protein Sequence | MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T38745-Ab | Anti-DFFA/ DFF-45/ DFF1 monoclonal antibody |
Target Antigen | GM-Tg-g-T38745-Ag | DFFA VLP (virus-like particle) |
ORF Viral Vector | pGMLP003287 | Human DFFA Lentivirus plasmid |
ORF Viral Vector | pGMLP003878 | Human DFFA Lentivirus plasmid |
ORF Viral Vector | vGMLP003287 | Human DFFA Lentivirus particle |
ORF Viral Vector | vGMLP003878 | Human DFFA Lentivirus particle |
Target information
Target ID | GM-T38745 |
Target Name | DFFA |
Gene ID | 1676, 13347, 713544, 114214, 101096745, 487449, 507981, 100057041 |
Gene Symbol and Synonyms | A330085O09Rik,DFF-45,DFF1,DFF35,Dff45,DFFA,ICAD,ICAD-L,ICAD-S |
Uniprot Accession | O00273 |
Uniprot Entry Name | DFFA_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000160049 |
Target Classification | Not Available |
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.