Human DFFA/DFF-45/DFF1 ORF/cDNA clone-Lentivirus plasmid (BC007721)

Cat. No.: pGMLP003878
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DFFA/DFF-45/DFF1 Lentiviral expression plasmid for DFFA lentivirus packaging, DFFA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DFFA/DFF-45 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $549
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003878
Gene Name DFFA
Accession Number BC007721
Gene ID 1676
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias DFF-45,DFF1,ICAD
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGTGACCGGGGACGCCGGGGTACCAGAATCTGGCGAGATCCGGACTCTAAAGCCGTGTCTGCTGCGCCGCAACTACAGCCGCGAACAGCACGGCGTGGCCGCCTCCTGCCTCGAAGACCTGAGGAGCAAGGCCTGTGACATTCTGGCCATTGATAAGTCCCTGACACCAGTCACCCTGGTCCTGGCAGAGGATGGCACCATAGTGGATGATGACGATTACTTTCTGTGTCTACCTTCCAATACTAAGTTTGTGGCATTGGCTAGTAATGAGAAATGGGCATACAACAATTCAGATGGAGGTACAGCTTGGATTTCCCAAGAGTCCTTTGATGTAGATGAAACAGACAGCGGGGCAGGGTTGAAGTGGAAGAATGTGGCCAGGCAGCTGAAAGAAGATCTGTCCAGCATCATCCTCCTATCAGAGGAGGACCTCCAGATGCTTGTTGACGCTCCCTGCTCAGACCTGGCTCAGGAACTACGTCAGAGTTGTGCCACCGTCCAGCGGCTGCAGCACACACTCCAACAGGTGCTTGACCAAAGAGAGGAAGTGCGTCAGTCCAAGCAGCTCCTGCAGCTGTACCTCCAGGCTTTGGAGAAAGAGGGCAGCCTCTTGTCAAAGCAGGAAGAGTCCAAAGCTGCCTTTGGTGAGGAGGTGGATGCAGTAGACACGGGTATCAGCAGAGAGACCTCCTCGGACGTTGCGCTGGCGAGCCACATCCTTACTGCACTGAGGGAGAAGCAGGCTCCAGAGCTGAGCTTATCTAGTCAGGATTTGGAGTTGGTTACCAAGGAAGACCCCAAAGCACTGGCTGTTGCCTTGAACTGGGACATAAAGAAGACGGAGACTGTTCAGGAGGCCTGTGAGTGGGAGCTCGCCCTGCGCCTGCAGCAGACGCAGAGCTTGCATTCTCTCCGGAGCATCTCAGCAAGCAAGGCCTCACCACCTGGTGACCTGCAGAATCCTAAGCGAGCCAGACAGGATCCCACATAG
ORF Protein Sequence MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T38745-Ab Anti-DFFA/ DFF-45/ DFF1 monoclonal antibody
    Target Antigen GM-Tg-g-T38745-Ag DFFA VLP (virus-like particle)
    ORF Viral Vector pGMLP003287 Human DFFA Lentivirus plasmid
    ORF Viral Vector pGMLP003878 Human DFFA Lentivirus plasmid
    ORF Viral Vector vGMLP003287 Human DFFA Lentivirus particle
    ORF Viral Vector vGMLP003878 Human DFFA Lentivirus particle


    Target information

    Target ID GM-T38745
    Target Name DFFA
    Gene ID 1676, 13347, 713544, 114214, 101096745, 487449, 507981, 100057041
    Gene Symbol and Synonyms A330085O09Rik,DFF-45,DFF1,DFF35,Dff45,DFFA,ICAD,ICAD-L,ICAD-S
    Uniprot Accession O00273
    Uniprot Entry Name DFFA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000160049
    Target Classification Not Available

    Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.