Human IRF2/IRF-2 ORF/cDNA clone-Lentivirus plasmid (NM_002199)
Cat. No.: pGMLP003958
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IRF2/IRF-2 Lentiviral expression plasmid for IRF2 lentivirus packaging, IRF2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IRF2/IRF-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003958 |
Gene Name | IRF2 |
Accession Number | NM_002199 |
Gene ID | 3660 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1050 bp |
Gene Alias | IRF-2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCGGTGGAAAGGATGCGCATGCGCCCGTGGCTGGAGGAGCAGATAAACTCCAACACGATCCCGGGGCTCAAGTGGCTTAACAAGGAAAAGAAGATTTTTCAGATCCCCTGGATGCATGCGGCTAGACATGGGTGGGATGTGGAAAAAGATGCACCACTCTTTAGAAACTGGGCAATCCATACAGGAAAGCATCAACCAGGAGTAGATAAACCTGATCCCAAAACATGGAAGGCGAATTTCAGATGCGCCATGAATTCCTTGCCTGATATTGAAGAAGTCAAGGATAAAAGCATAAAGAAAGGAAATAATGCCTTCAGGGTCTACCGAATGCTGCCCCTATCAGAACGGCCTTCTAAGAAAGGAAAGAAACCAAAGACAGAAAAAGAAGACAAAGTTAAGCACATCAAGCAAGAACCAGTTGAGTCATCTCTGGGGCTTAGTAATGGAGTAAGTGATCTTTCTCCTGAGTATGCGGTCCTGACTTCAACTATAAAAAATGAAGTGGATAGTACGGTGAACATCATAGTTGTAGGACAGTCCCATCTGGACAGCAACATTGAGAATCAAGAGATTGTCACCAATCCGCCAGACATTTGCCAAGTTGTAGAGGTGACCACTGAGAGCGACGAGCAGCCGGTCAGCATGAGCGAGCTCTACCCTCTGCAGATCTCCCCCGTGTCTTCCTATGCAGAAAGCGAAACGACTGATAGTGTGCCCAGCGATGAAGAGAGTGCCGAGGGGCGGCCACACTGGCGGAAGAGGAATATTGAAGGCAAACAGTACCTCAGCAACATGGGGACTCGAGGCTCCTACCTGCTGCCCGGCATGGCGTCCTTCGTCACTTCCAACAAACCGGACCTCCAGGTCACCATCAAAGAGGAGAGCAATCCGGTGCCTTACAACAGCTCCTGGCCCCCTTTTCAAGACCTCCCCCTTTCTTCCTCCATGACCCCAGCATCCAGCAGCAGTCGGCCAGACCGGGAGACCCGGGCCAGCGTCATCAAGAAAACATCGGATATCACCCAGGCCCGCGTCAAGAGCTGTTAA |
ORF Protein Sequence | MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2551-Ab | Anti-IRF2 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2551-Ag | IRF2 protein |
ORF Viral Vector | pGMLP003958 | Human IRF2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003958 | Human IRF2 Lentivirus particle |
Target information
Target ID | GM-IP2551 |
Target Name | IRF2 |
Gene ID | 3660, 16363, 694347, 290749, 101089600, 475633, 337916, 100050990 |
Gene Symbol and Synonyms | 9830146E22Rik,IRF-2,IRF2 |
Uniprot Accession | P14316 |
Uniprot Entry Name | IRF2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000168310 |
Target Classification | Tumor-associated antigen (TAA) |
IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.