Human IRF2/IRF-2 ORF/cDNA clone-Lentivirus particle (NM_002199)
Cat. No.: vGMLP003958
Pre-made Human IRF2/IRF-2 Lentiviral expression plasmid for IRF2 lentivirus packaging, IRF2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IRF2/IRF-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003958 | Human IRF2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003958 |
| Gene Name | IRF2 |
| Accession Number | NM_002199 |
| Gene ID | 3660 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1050 bp |
| Gene Alias | IRF-2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCGGTGGAAAGGATGCGCATGCGCCCGTGGCTGGAGGAGCAGATAAACTCCAACACGATCCCGGGGCTCAAGTGGCTTAACAAGGAAAAGAAGATTTTTCAGATCCCCTGGATGCATGCGGCTAGACATGGGTGGGATGTGGAAAAAGATGCACCACTCTTTAGAAACTGGGCAATCCATACAGGAAAGCATCAACCAGGAGTAGATAAACCTGATCCCAAAACATGGAAGGCGAATTTCAGATGCGCCATGAATTCCTTGCCTGATATTGAAGAAGTCAAGGATAAAAGCATAAAGAAAGGAAATAATGCCTTCAGGGTCTACCGAATGCTGCCCCTATCAGAACGGCCTTCTAAGAAAGGAAAGAAACCAAAGACAGAAAAAGAAGACAAAGTTAAGCACATCAAGCAAGAACCAGTTGAGTCATCTCTGGGGCTTAGTAATGGAGTAAGTGATCTTTCTCCTGAGTATGCGGTCCTGACTTCAACTATAAAAAATGAAGTGGATAGTACGGTGAACATCATAGTTGTAGGACAGTCCCATCTGGACAGCAACATTGAGAATCAAGAGATTGTCACCAATCCGCCAGACATTTGCCAAGTTGTAGAGGTGACCACTGAGAGCGACGAGCAGCCGGTCAGCATGAGCGAGCTCTACCCTCTGCAGATCTCCCCCGTGTCTTCCTATGCAGAAAGCGAAACGACTGATAGTGTGCCCAGCGATGAAGAGAGTGCCGAGGGGCGGCCACACTGGCGGAAGAGGAATATTGAAGGCAAACAGTACCTCAGCAACATGGGGACTCGAGGCTCCTACCTGCTGCCCGGCATGGCGTCCTTCGTCACTTCCAACAAACCGGACCTCCAGGTCACCATCAAAGAGGAGAGCAATCCGGTGCCTTACAACAGCTCCTGGCCCCCTTTTCAAGACCTCCCCCTTTCTTCCTCCATGACCCCAGCATCCAGCAGCAGTCGGCCAGACCGGGAGACCCGGGCCAGCGTCATCAAGAAAACATCGGATATCACCCAGGCCCGCGTCAAGAGCTGTTAA |
| ORF Protein Sequence | MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2551-Ab | Anti-IRF2 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2551-Ag | IRF2 protein |
| ORF Viral Vector | pGMLP003958 | Human IRF2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003958 | Human IRF2 Lentivirus particle |
Target information
| Target ID | GM-IP2551 |
| Target Name | IRF2 |
| Gene ID | 3660, 16363, 694347, 290749, 101089600, 475633, 337916, 100050990 |
| Gene Symbol and Synonyms | 9830146E22Rik,IRF-2,IRF2 |
| Uniprot Accession | P14316 |
| Uniprot Entry Name | IRF2_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Cancer |
| Gene Ensembl | ENSG00000168310 |
| Target Classification | Tumor-associated antigen (TAA) |
IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


