Human TBC1D10C/CARABIN/EPI64C ORF/cDNA clone-Lentivirus plasmid (NM_198517)

Cat. No.: pGMLP004136
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TBC1D10C/CARABIN/EPI64C Lentiviral expression plasmid for TBC1D10C lentivirus packaging, TBC1D10C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TBC1D10C/CARABIN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $675.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004136
Gene Name TBC1D10C
Accession Number NM_198517
Gene ID 374403
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1341 bp
Gene Alias CARABIN,EPI64C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCAGGCCCTGGGGGAGGACCTGGTGCAGCCTCCCGAGCTGCAGGATGACTCCAGCTCCTTGGGGTCCGACTCAGAGCTCAGCGGGCCTGGCCCATATCGCCAGGCCGACCGCTATGGATTCATTGGGGGCAGCTCAGCAGAGCCAGGGCCGGGCCACCCACCTGCAGACCTCATCCGCCAACGGGAGATGAAGTGGGTGGAGATGACCTCGCACTGGGAGAAAACCATGTCCCGGCGGTACAAGAAGGTAAAGATGCAGTGCCGGAAAGGCATCCCGTCTGCCCTGCGCGCCCGATGCTGGCCCCTGTTGTGTGGGGCCCATGTGTGCCAGAAGAACAGCCCTGGCACCTATCAGGAGCTGGCAGAGGCCCCTGGAGACCCACAGTGGATGGAGACCATTGGCAGGGACCTGCACCGTCAATTCCCTCTGCACGAGATGTTTGTGTCGCCTCAGGGCCACGGGCAGCAGGGGCTCCTGCAGGTGCTCAAGGCCTACACCCTGTATCGACCGGAGCAGGGCTACTGCCAGGCCCAGGGGCCCGTGGCTGCTGTGCTGCTCATGCACCTGCCCCCAGAGGAGGCCTTCTGGTGCCTGGTGCAGATCTGTGAGGTCTACCTCCCTGGGTACTACGGGCCCCACATGGAGGCTGTGCGGCTGGACGCCGAGGTGTTCATGGCCCTGCTGCGGCGGCTGCTTCCGCACGTGCACAAGCACCTGCAGCAGGTGGGCGTCGGACCCCTGCTGTACCTGCCCGAGTGGTTCCTGTGCCTCTTCGCCCGCTCCCTGCCCTTCCCCACAGTGCTGCGTGTCTGGGATGCCTTCCTCAGTGAGGGTGCCAGAGTACTGTTCCGTGTGGGGCTGACACTGGTGCGCCTGGCGCTGGGCACTGCAGAGCAGCGAGGGGCCTGCCCTGGCCTCCTGGAGACACTGGGAGCCCTTCGAGCCATCCCCCCCGCGCAGCTGCAGGAGGAGGCCTTCATGTCACAGGTGCACAGCGTGGTGCTGTCAGAGCGGGACCTGCAGCGGGAGATCAAGGCCCAGCTGGCCCAGCTGCCCGATTCCGCGCCGGGACCCCCGCCCCGGCCACAGGTCCGCCTCGCCGGGGCCCAAGCCATCTTTGAGGCCCAGCAGCTGGCAGGAGTGCGACGAGGCGCCAAGCCTGAGGTGCCTCGGATTGTGGTGCAGCCCCCGGAGGAGCCCAGACCACCGCGGCGGAAACCCCAGACCCGCGGCAAGACTTTCCATGGGCTCCTGACTCGGGCCCGGGGCCCCCCCATCGAGGGGCCCCCCAGGCCCCAACGAGGCTCCACCTCCTTCCTGGACACCCGCTTCTGA
ORF Protein Sequence MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLLTRARGPPIEGPPRPQRGSTSFLDTRF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1782-Ab Anti-TB10C/ TBC1D10C/ CARABIN monoclonal antibody
    Target Antigen GM-Tg-g-MP1782-Ag TBC1D10C VLP (virus-like particle)
    ORF Viral Vector pGMLP004136 Human TBC1D10C Lentivirus plasmid
    ORF Viral Vector pGMPC001252 Human TBC1D10C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004136 Human TBC1D10C Lentivirus particle


    Target information

    Target ID GM-MP1782
    Target Name TBC1D10C
    Gene ID 374403, 108995, 712270, 361697, 101091561, 610509, 520599, 100146355
    Gene Symbol and Synonyms 1810062O14Rik,CARABIN,EPI64C,RGD1311490,TBC1D10C
    Uniprot Accession Q8IV04
    Uniprot Entry Name TB10C_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000175463
    Target Classification Not Available

    The protein encoded by this gene has an N-terminal Rab-GTPase domain and a binding site at the C-terminus for calcineurin, and is an inhibitor of both the Ras signaling pathway and calcineurin, a phosphatase regulated by calcium and calmodulin. Genes encoding similar proteins are located on chromosomes 16 and 22. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.