Human RPLP2/D11S2243E/LP2 ORF/cDNA clone-Lentivirus plasmid (NM_001004)

Cat. No.: pGMLP004212
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RPLP2/D11S2243E/LP2 Lentiviral expression plasmid for RPLP2 lentivirus packaging, RPLP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RPLP2/D11S2243E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004212
Gene Name RPLP2
Accession Number NM_001004
Gene ID 6181
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 348 bp
Gene Alias D11S2243E,LP2,P2,RPP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGCTACGTCGCCTCCTACCTGCTGGCTGCCCTAGGGGGCAACTCCTCCCCCAGCGCCAAGGACATCAAGAAGATCTTGGACAGCGTGGGTATCGAGGCGGACGACGACCGGCTCAACAAGGTTATCAGTGAGCTGAATGGAAAAAACATTGAAGACGTCATTGCCCAGGGTATTGGCAAGCTTGCCAGTGTACCTGCTGGTGGGGCTGTAGCCGTCTCTGCTGCCCCAGGCTCTGCAGCCCCTGCTGCTGGTTCTGCCCCTGCTGCAGCAGAGGAGAAGAAAGATGAGAAGAAGGAGGAGTCTGAAGAGTCAGATGATGACATGGGATTTGGCCTTTTTGATTAA
ORF Protein Sequence MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0452-Ab Anti-RLA2/ RPLP2/ D11S2243E functional antibody
    Target Antigen GM-Tg-g-SE0452-Ag RPLP2 protein
    ORF Viral Vector pGMLP004212 Human RPLP2 Lentivirus plasmid
    ORF Viral Vector vGMLP004212 Human RPLP2 Lentivirus particle


    Target information

    Target ID GM-SE0452
    Target Name RPLP2
    Gene ID 6181, 67186, 700698, 140662, 101098579, 475991, 286853, 100034001
    Gene Symbol and Synonyms 2700049I22Rik,D11S2243E,LP2,P2,RP2,RPLP2,RPP2
    Uniprot Accession P05387
    Uniprot Entry Name RLA2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177600
    Target Classification Not Available

    Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.