Human OR1D2/OLFR1/OR17-4 ORF/cDNA clone-Lentivirus plasmid (NM_002548)

Cat. No.: pGMLP004286
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human OR1D2/OLFR1/OR17-4 Lentiviral expression plasmid for OR1D2 lentivirus packaging, OR1D2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to OR1D2/OLFR1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $534.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004286
Gene Name OR1D2
Accession Number NM_002548
Gene ID 4991
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 939 bp
Gene Alias OLFR1,OR17-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGGAGGCAACCAGAGTGAAGGTTCAGAGTTCCTTCTCCTGGGGATGTCAGAGAGTCCTGAGCAGCAGCGGATCCTGTTTTGGATGTTCCTGTCCATGTACCTGGTCACGGTGGTGGGAAATGTGCTCATCATCCTGGCCATCAGCTCTGATTCCCGCCTGCACACCCCCGTGTACTTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACAATCCCCAAGATGCTGGTGAACCTCCAGTCCCATAACAAAGCCATCTCCTATGCAGGGTGTCTGACACAGCTCTACTTCCTGGTCTCCTTGGTGGCCCTGGACAACCTCATCCTGGCTGTGATGGCATATGACCGCTATGTGGCCATCTGCTGCCCCCTCCACTACACCACAGCCATGAGCCCTAAGCTCTGTATCTTACTCCTTTCCTTGTGTTGGGTCCTATCCGTCCTCTATGGCCTCATACACACCCTCCTCATGACCAGAGTGACCTTCTGTGGGTCACGAAAAATCCACTACATCTTCTGTGAGATGTATGTATTGCTGAGGATGGCATGTTCCAACATTCAGATTAATCACACAGTGCTGATTGCCACAGGCTGCTTCATCTTCCTCATTCCCTTTGGATTCGTGATCATTTCCTATGTGCTGATTATCAGAGCCATCCTCAGAATACCCTCAGTCTCTAAGAAATACAAAGCCTTCTCCACCTGTGCCTCCCATTTGGGTGCAGTCTCCCTCTTCTATGGGACACTTTGTATGGTATACCTAAAGCCCCTCCATACCTACTCTGTGAAGGACTCAGTAGCCACAGTGATGTATGCTGTGGTGACACCCATGATGAATCCCTTCATCTACAGCCTGAGGAACAAGGACATGCATGGGGCTCTGGGAAGACTCCTAGATAAACACTTTAAGAGGCTGACATGA
ORF Protein Sequence MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVYFFLANLSFTDLFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAYDRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRMACSNIQINHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSVSKKYKAFSTCASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0994-Ab Anti-OR1D2/ OLFR1/ OR17-4 monoclonal antibody
    Target Antigen GM-Tg-g-MP0994-Ag OR1D2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004286 Human OR1D2 Lentivirus plasmid
    ORF Viral Vector vGMLP004286 Human OR1D2 Lentivirus particle


    Target information

    Target ID GM-MP0994
    Target Name OR1D2
    Gene ID 4991, 287517
    Gene Symbol and Synonyms OLFR1,Olr1519,OR17-4,OR1D2
    Uniprot Accession P34982
    Uniprot Entry Name OR1D2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000184166
    Target Classification Not Available

    Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.