Human CLEC4D/CD368/CLEC-6 ORF/cDNA clone-Lentivirus plasmid (NM_080387)

Cat. No.: pGMLP004359
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLEC4D/CD368/CLEC-6 Lentiviral expression plasmid for CLEC4D lentivirus packaging, CLEC4D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CLEC4D/CD368 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004359
Gene Name CLEC4D
Accession Number NM_080387
Gene ID 338339
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 648 bp
Gene Alias CD368,CLEC-6,CLEC6,CLECSF8,Dectin-3,MCL,MPCL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTAGAAAAACCTCAAAGTAAACTGGAAGGAGGCATGCATCCCCAGCTGATACCTTCGGTTATTGCTGTAGTTTTCATCTTACTTCTCAGTGTCTGTTTTATTGCAAGTTGTTTGGTGACTCATCACAACTTTTCACGCTGTAAGAGAGGCACAGGAGTGCACAAGTTAGAGCACCATGCAAAGCTCAAATGCATCAAAGAGAAATCAGAACTGAAAAGTGCTGAAGGGAGCACCTGGAACTGTTGTCCTATTGACTGGAGAGCCTTCCAGTCCAACTGCTATTTTCCTCTTACTGACAACAAGACGTGGGCTGAGAGTGAAAGGAACTGTTCAGGGATGGGGGCCCATCTGATGACCATCAGCACGGAAGCTGAGCAGAACTTTATTATTCAGTTTCTGGATAGACGGCTTTCCTATTTCCTTGGACTTAGAGATGAGAATGCCAAAGGTCAGTGGCGTTGGGTGGACCAGACGCCATTTAACCCACGCAGAGTATTCTGGCATAAGAATGAACCCGACAACTCTCAGGGAGAAAACTGTGTTGTTCTTGTTTATAACCAAGATAAATGGGCCTGGAATGATGTTCCTTGTAACTTTGAAGCAAGTAGGATTTGTAAAATACCTGGAACAACATTGAACTAG
ORF Protein Sequence MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0297-Ab Anti-CLC4D/ CLEC4D/ CD368 monoclonal antibody
    Target Antigen GM-Tg-g-MP0297-Ag CLEC4D VLP (virus-like particle)
    ORF Viral Vector pGMLP004359 Human CLEC4D Lentivirus plasmid
    ORF Viral Vector vGMLP004359 Human CLEC4D Lentivirus particle


    Target information

    Target ID GM-MP0297
    Target Name CLEC4D
    Gene ID 338339, 17474, 716298, 362432, 101095108, 616646, 100060606
    Gene Symbol and Synonyms CD368,CLEC-6,CLEC4D,CLEC6,CLECSF8,Dectin-3,MCL,MPCL
    Uniprot Accession Q8WXI8
    Uniprot Entry Name CLC4D_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166527
    Target Classification Not Available

    This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.