Human SPINK13/HBVDNAPTP1/HESPINTOR ORF/cDNA clone-Lentivirus plasmid (NM_001040129)

Cat. No.: pGMLP004365
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPINK13/HBVDNAPTP1/HESPINTOR Lentiviral expression plasmid for SPINK13 lentivirus packaging, SPINK13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SPINK13/HBVDNAPTP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004365
Gene Name SPINK13
Accession Number NM_001040129
Gene ID 153218
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 285 bp
Gene Alias HBVDNAPTP1,HESPINTOR,LiESP6,SPINK5L3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCTTTCCCCACAAGATTATATTTTTCCTGGTATGCTCTACTTTGACACATGTGGCTTTCTCAGGAATTTTCAATAAACGTGACTTCACTAGGTGGCCTAAGCCCCGATGTAAAATGTATATCCCACTGGACCCTGATTACAATGCAGACTGCCCCAATGTGACAGCACCTGTTTGTGCCTCAAATGGCCACACTTTCCAGAATGAGTGTTTCTTTTGTGTTGAACAGAGGGAATTTCATTATCGTATAAAATTTGAAAAATATGGAAAATGTGATTAA
ORF Protein Sequence MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0480-Ab Anti-ISK13/ SPINK13/ HBVDNAPTP1 functional antibody
    Target Antigen GM-Tg-g-SE0480-Ag SPINK13 protein
    ORF Viral Vector pGMLP004365 Human SPINK13 Lentivirus plasmid
    ORF Viral Vector vGMLP004365 Human SPINK13 Lentivirus particle


    Target information

    Target ID GM-SE0480
    Target Name SPINK13
    Gene ID 153218, 100038417, 100329159, 689570, 102151912, 104972860
    Gene Symbol and Synonyms Gm10534,HBVDNAPTP1,HESPINTOR,LiESP6,SPINK13,SPINK5L3
    Uniprot Accession Q1W4C9
    Uniprot Entry Name ISK13_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214510
    Target Classification Not Available

    Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of acrosome reaction. Predicted to be located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.