Human BTG1/APRO2 ORF/cDNA clone-Lentivirus plasmid (NM_001731)

Cat. No.: pGMLP004367
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BTG1/APRO2 Lentiviral expression plasmid for BTG1 lentivirus packaging, BTG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to BTG1/APRO2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $429
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004367
Gene Name BTG1
Accession Number NM_001731
Gene ID 694
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 516 bp
Gene Alias APRO2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCCCTTCTACACCCGGGCCGCCACCATGATAGGCGAGATCGCCGCCGCCGTGTCCTTCATCTCCAAGTTTCTCCGCACCAAGGGGCTCACGAGCGAGCGACAGCTGCAGACCTTCAGCCAGAGCCTGCAGGAGCTGCTGGCAGAACATTATAAACATCACTGGTTCCCAGAAAAGCCATGCAAGGGATCGGGTTACCGTTGTATTCGCATCAACCATAAAATGGATCCTCTGATTGGACAGGCAGCACAGCGGATTGGACTGAGCAGTCAGGAGCTGTTCAGGCTTCTCCCAAGTGAACTCACACTCTGGGTTGACCCCTATGAAGTGTCCTACAGAATTGGAGAGGATGGCTCCATCTGTGTGCTGTATGAAGCCTCACCAGCAGGAGGTAGCACTCAAAACAGCACCAACGTGCAAATGGTAGACAGCCGAATCAGCTGTAAGGAGGAACTTCTCTTGGGCAGAACGAGCCCTTCCAAAAACTACAATATGATGACTGTATCAGGTTAA
ORF Protein Sequence MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45357-Ab Anti-BTG1 monoclonal antibody
    Target Antigen GM-Tg-g-T45357-Ag BTG1 protein
    ORF Viral Vector pGMLP004367 Human BTG1 Lentivirus plasmid
    ORF Viral Vector pGMLV001948 Human BTG1 Lentivirus plasmid
    ORF Viral Vector vGMLP004367 Human BTG1 Lentivirus particle
    ORF Viral Vector vGMLV001948 Human BTG1 Lentivirus particle


    Target information

    Target ID GM-T45357
    Target Name BTG1
    Gene ID 694, 12226, 710112, 29618, 101101647, 100684605, 281032, 100629230
    Gene Symbol and Synonyms APRO2,BTG1
    Uniprot Accession P62324
    Uniprot Entry Name BTG1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000133639
    Target Classification Not Available

    This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia. [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.