Human BTG1/APRO2 ORF/cDNA clone-Lentivirus particle (NM_001731.3)
Cat. No.: vGMLV001948
Pre-made Human BTG1/APRO2 Lentiviral expression plasmid for BTG1 lentivirus packaging, BTG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
BTG1/APRO2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV001948 | Human BTG1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV001948 |
| Gene Name | BTG1 |
| Accession Number | NM_001731.3 |
| Gene ID | 694 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 516 bp |
| Gene Alias | APRO2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCATCCCTTCTACACCCGGGCCGCCACCATGATAGGCGAGATCGCCGCCGCCGTGTCCTTCATCTCCAAGTTTCTCCGCACCAAGGGGCTCACGAGCGAGCGACAGCTGCAGACCTTCAGCCAGAGCCTGCAGGAGCTGCTGGCAGAACATTATAAACATCACTGGTTCCCAGAAAAGCCATGCAAGGGATCGGGTTACCGTTGTATTCGCATCAACCATAAAATGGATCCTCTGATTGGACAGGCAGCACAGCGGATTGGACTGAGCAGTCAGGAGCTGTTCAGGCTTCTCCCAAGTGAACTCACACTCTGGGTTGACCCCTATGAAGTGTCCTACAGAATTGGAGAGGATGGCTCCATCTGTGTGCTGTATGAAGCCTCACCAGCAGGAGGTAGCACTCAAAACAGCACCAACGTGCAAATGGTAGACAGCCGAATCAGCTGTAAGGAGGAACTTCTCTTGGGCAGAACGAGCCCTTCCAAAAACTACAATATGATGACTGTATCAGGTTAA |
| ORF Protein Sequence | MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T45357-Ab | Anti-BTG1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T45357-Ag | BTG1 protein |
| ORF Viral Vector | pGMLP004367 | Human BTG1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001948 | Human BTG1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004367 | Human BTG1 Lentivirus particle |
| ORF Viral Vector | vGMLV001948 | Human BTG1 Lentivirus particle |
Target information
| Target ID | GM-T45357 |
| Target Name | BTG1 |
| Gene ID | 694, 12226, 710112, 29618, 101101647, 100684605, 281032, 100629230 |
| Gene Symbol and Synonyms | APRO2,BTG1 |
| Uniprot Accession | P62324 |
| Uniprot Entry Name | BTG1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000133639 |
| Target Classification | Not Available |
This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia. [provided by RefSeq, Oct 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


