Human MRGPRF/GPR140/GPR168 ORF/cDNA clone-Lentivirus plasmid (NM_145015)

Cat. No.: pGMLP004427
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MRGPRF/GPR140/GPR168 Lentiviral expression plasmid for MRGPRF lentivirus packaging, MRGPRF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MRGPRF/GPR140 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $588.96
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004427
Gene Name MRGPRF
Accession Number NM_145015
Gene ID 116535
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1032 bp
Gene Alias GPR140,GPR168,MRGF,RTA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGGAAACTGCTCCTGGGAGGCCCATCCCGGCAACAGGAACAAGATGTGCCCTGGCCTGAGCGAGGCCCCGGAACTCTACAGCCGGGGCTTCCTGACCATCGAGCAGATCGCGATGCTGCCGCCTCCGGCCGTCATGAACTACATCTTCCTGCTCCTCTGCCTGTGTGGCCTGGTGGGCAACGGGCTGGTCCTCTGGTTTTTCGGCTTCTCCATCAAGAGGAACCCCTTCTCCATCTACTTCCTGCACCTGGCCAGCGCCGATGTGGGCTACCTCTTCAGCAAGGCGGTGTTCTCCATCCTGAACACGGGGGGCTTCCTGGGCACGTTTGCCGACTACATCCGCAGCGTGTGCCGGGTCCTGGGGCTCTGCATGTTCCTTACCGGCGTGAGCCTCCTGCCGGCCGTCAGCGCCGAGCGCTGCGCCTCGGTCATCTTCCCCGCCTGGTACTGGCGCCGGCGGCCCAAGCGCCTGTCGGCCGTGGTGTGCGCCCTGCTGTGGGTCCTGTCCCTCCTGGTCACCTGCCTGCACAACTACTTCTGCGTGTTCCTGGGCCGCGGGGCCCCCGGCGCGGCCTGCAGGCACATGGACATCTTCCTGGGCATCCTCCTGTTCCTGCTCTGCTGCCCGCTCATGGTGCTGCCCTGCCTGGCCCTCATCCTGCACGTGGAGTGCCGGGCCCGACGGCGCCAGCGCTCTGCCAAGCTCAACCACGTCATCCTGGCCATGGTCTCCGTCTTCCTGGTGTCCTCCATCTACTTAGGGATCGACTGGTTCCTCTTCTGGGTCTTCCAGATCCCGGCCCCCTTCCCCGAGTACGTCACTGACCTGTGCATCTGCATCAACAGCAGCGCCAAGCCCATCGTCTACTTCCTGGCCGGGAGGGACAAGTCGCAGCGGCTGTGGGAGCCGCTCAGGGTGGTCTTCCAGCGGGCCCTGCGGGACGGCGCTGAGCTGGGGGAGGCCGGGGGCAGCACGCCCAACACAGTCACCATGGAGATGCAGTGTCCCCCGGGGAACGCCTCCTGA
ORF Protein Sequence MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0832-Ab Anti-MRGRF/ MRGPRF/ GPR140 monoclonal antibody
    Target Antigen GM-Tg-g-MP0832-Ag MRGPRF VLP (virus-like particle)
    ORF Viral Vector pGMLP004427 Human MRGPRF Lentivirus plasmid
    ORF Viral Vector vGMLP004427 Human MRGPRF Lentivirus particle


    Target information

    Target ID GM-MP0832
    Target Name MRGPRF
    Gene ID 116535, 211577, 721546, 266762, 483684, 615886, 100049010
    Gene Symbol and Synonyms GPR140,GPR168,Mgrc,MRGF,MRGPRF,RTA
    Uniprot Accession Q96AM1
    Uniprot Entry Name MRGRF_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000172935
    Target Classification GPCR

    Predicted to enable G protein-coupled receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in nuclear membrane and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.