Human GML/LY6DL ORF/cDNA clone-Lentivirus plasmid (NM_002066)

Cat. No.: pGMLP004457
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GML/LY6DL Lentiviral expression plasmid for GML lentivirus packaging, GML lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GML/LY6DL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004457
Gene Name GML
Accession Number NM_002066
Gene ID 2765
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 477 bp
Gene Alias LY6DL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCCTCTTTGCCTTACTCCTAGCCATGGAGCTCCCATTGGTGGCAGCCAGTGCCACCATGCGCGCTCAGTGGACTTACAGTTTGAGATGCCATGACTGTGCGGTCATAAATGACTTCAACTGTCCCAACATTAGAGTATGTCCGTATCATATTAGGCGCTGTATGACAATCTCCATTCGCATAAATTCTCGTGAACTACTTGTTTATAAGAACTGTACAAACAACTGCACATTTGTATATGCAGCTGAACAGCCTCCTGAAGCCCCAGGAAAAATCTTCAAAACTAATAGCTTCTACTGGGTTTGTTGTTGTAATAGCATGGTTTGCAATGCAGGAGGACCTACTAATCTTGAAAGGGACATGTTACCCGATGAAGTAACTGAGGAGGAGCTTCCAGAAGGAACTGTGAGGCTGGGGGTATCAAAACTGTTGCTGAGTTTTGCCTCTATCATAGTCAGCAATATATTGCCATGA
ORF Protein Sequence MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0484-Ab Anti-GML/ LY6DL monoclonal antibody
    Target Antigen GM-Tg-g-MP0484-Ag GML VLP (virus-like particle)
    ORF Viral Vector pGMLP004457 Human GML Lentivirus plasmid
    ORF Viral Vector vGMLP004457 Human GML Lentivirus particle


    Target information

    Target ID GM-MP0484
    Target Name GML
    Gene ID 2765, 625599, 705046, 300019, 102899674, 119874441, 767955, 100630161
    Gene Symbol and Synonyms EG625599,GML,HemT,LY6DL
    Uniprot Accession Q99445
    Uniprot Entry Name GML_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000104499
    Target Classification Not Available

    Predicted to be involved in DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; apoptotic process; and negative regulation of cell population proliferation. Predicted to be extrinsic component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.