Human KCNE3/HOKPP/HYPP ORF/cDNA clone-Lentivirus plasmid (NM_005472)
Cat. No.: pGMLP004461
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human KCNE3/HOKPP/HYPP Lentiviral expression plasmid for KCNE3 lentivirus packaging, KCNE3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
KCNE3/HOKPP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004461 |
Gene Name | KCNE3 |
Accession Number | NM_005472 |
Gene ID | 10008 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 312 bp |
Gene Alias | HOKPP,HYPP,MiRP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGACTACCAATGGAACGGAGACCTGGTATGAGAGCCTGCATGCCGTGCTGAAGGCTCTAAATGCCACTCTTCACAGCAATTTGCTCTGCCGGCCAGGGCCAGGGCTGGGGCCAGACAACCAGACTGAAGAGAGGCGGGCCAGCCTACCTGGCCGTGATGACAACTCCTACATGTACATTCTCTTTGTCATGTTTCTATTTGCTGTAACTGTGGGCAGCCTCATCCTGGGATACACCCGCTCCCGCAAAGTGGACAAGCGTAGTGACCCCTATCATGTGTATATCAAGAACCGTGTGTCTATGATCTAA |
ORF Protein Sequence | METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0657-Ab | Anti-KCNE3/ HOKPP/ HYPP monoclonal antibody |
Target Antigen | GM-Tg-g-MP0657-Ag | KCNE3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004461 | Human KCNE3 Lentivirus plasmid |
ORF Viral Vector | vGMLP004461 | Human KCNE3 Lentivirus particle |
Target information
Target ID | GM-MP0657 |
Target Name | KCNE3 |
Gene ID | 10008, 57442, 718902, 63883, 101094205, 485197, 527762, 100065199 |
Gene Symbol and Synonyms | 2210017H05Rik,BRGDA6,HOKPP,HYPP,KCNE3,MiRP2 |
Uniprot Accession | Q9Y6H6 |
Uniprot Entry Name | KCNE3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000175538 |
Target Classification | Not Available |
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the kidney. A missense mutation in this gene is associated with hypokalemic periodic paralysis. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.