Human KCNE3/HOKPP/HYPP ORF/cDNA clone-Lentivirus plasmid (NM_005472)

Cat. No.: pGMLP004461
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KCNE3/HOKPP/HYPP Lentiviral expression plasmid for KCNE3 lentivirus packaging, KCNE3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to KCNE3/HOKPP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004461
Gene Name KCNE3
Accession Number NM_005472
Gene ID 10008
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 312 bp
Gene Alias HOKPP,HYPP,MiRP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGACTACCAATGGAACGGAGACCTGGTATGAGAGCCTGCATGCCGTGCTGAAGGCTCTAAATGCCACTCTTCACAGCAATTTGCTCTGCCGGCCAGGGCCAGGGCTGGGGCCAGACAACCAGACTGAAGAGAGGCGGGCCAGCCTACCTGGCCGTGATGACAACTCCTACATGTACATTCTCTTTGTCATGTTTCTATTTGCTGTAACTGTGGGCAGCCTCATCCTGGGATACACCCGCTCCCGCAAAGTGGACAAGCGTAGTGACCCCTATCATGTGTATATCAAGAACCGTGTGTCTATGATCTAA
ORF Protein Sequence METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0657-Ab Anti-KCNE3/ HOKPP/ HYPP monoclonal antibody
    Target Antigen GM-Tg-g-MP0657-Ag KCNE3 VLP (virus-like particle)
    ORF Viral Vector pGMLP004461 Human KCNE3 Lentivirus plasmid
    ORF Viral Vector vGMLP004461 Human KCNE3 Lentivirus particle


    Target information

    Target ID GM-MP0657
    Target Name KCNE3
    Gene ID 10008, 57442, 718902, 63883, 101094205, 485197, 527762, 100065199
    Gene Symbol and Synonyms 2210017H05Rik,BRGDA6,HOKPP,HYPP,KCNE3,MiRP2
    Uniprot Accession Q9Y6H6
    Uniprot Entry Name KCNE3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000175538
    Target Classification Not Available

    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the kidney. A missense mutation in this gene is associated with hypokalemic periodic paralysis. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.