Human C6ORF57/C6orf57/Sdh8 ORF/cDNA clone-Lentivirus plasmid (NM_145267)

Cat. No.: pGMLP004692
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human C6ORF57/C6orf57/Sdh8 Lentiviral expression plasmid for C6ORF57 lentivirus packaging, C6ORF57 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SDHAF4/C6ORF57/C6orf57 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004692
Gene Name C6ORF57
Accession Number NM_145267
Gene ID 135154
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 327 bp
Gene Alias C6orf57,Sdh8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCCATCGAGGCTTCCCTGGTTGCTTAGCTGGGTCTCGGCCACGGCGTGGAGAGCGGCAAGATCACCCCTTCTGTGTCATTCTCTGAGGAAAACAAGTTCTTCTCAAGGAGGAAAGTCTGAACTTGTCAAACAGTCCCTTAAGAAGCCGAAGTTACCAGAAGGTCGTTTTGATGCACCAGAGGATTCCCATTTAGAGAAAGAACCACTGGAAAAATTTCCAGATGATGTTAATCCAGTGACCAAAGAAAAAGGTGGACCCAGGGGCCCAGAACCTACCCGATATGGAGATTGGGAACGAAAAGGACGCTGTATTGATTTTTAA
ORF Protein Sequence MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1539-Ab Anti-SDHF4/ SDHAF4/ C6orf57 functional antibody
    Target Antigen GM-Tg-g-SE1539-Ag SDHAF4 protein
    ORF Viral Vector pGMLP004692 Human C6ORF57 Lentivirus plasmid
    ORF Viral Vector vGMLP004692 Human C6ORF57 Lentivirus particle


    Target information

    Target ID GM-SE1539
    Target Name SDHAF4
    Gene ID 135154, 68002, 717008, 685888, 101089864, 610894, 768071, 100629833
    Gene Symbol and Synonyms 1110058L19Rik,1700001E18Rik,C12H6orf57,C4H6orf57,C6orf57,C9H6orf57,Sdh8,SDHAF4
    Uniprot Accession Q5VUM1
    Uniprot Entry Name SDHF4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000154079
    Target Classification Not Available

    Predicted to enable enzyme activator activity. Involved in cellular respiration and mitochondrial respiratory chain complex II assembly. Predicted to be located in mitochondrial matrix. Predicted to be active in mitochondrion. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.