Human PSMP/PSMP ORF/cDNA clone-Lentivirus plasmid (NM_001044264)

Cat. No.: pGMLP004703
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PSMP/PSMP Lentiviral expression plasmid for PSMP lentivirus packaging, PSMP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MSMP/PSMP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004703
Gene Name PSMP
Accession Number NM_001044264
Gene ID 692094
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 420 bp
Gene Alias PSMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCTAAGGATGCTCTGGGCTGGACAGGCCAAGGGGATCCTAGGAGGCTGGGGGATCATCTGCTTGGTGATGTCTCTACTCCTCCAGCACCCAGGAGTCTACAGCAAGTGCTACTTCCAAGCTCAAGCCCCCTGTCACTATGAGGGGAAATATTTTACCCTGGGTGAGTCTTGGCTCCGCAAGGACTGTTTCCATTGCACCTGTCTGCATCCTGTTGGCGTGGGCTGCTGTGACACGTCCCAGCATCCCATCGACTTCCCGGCTGGGTGTGAGGTACGTCAGGAGGCAGGAACCTGCCAGTTCTCCTTGGTGCAAAAATCTGACCCTCGGCTGCCCTGCAAAGGGGGAGGGCCTGACCCAGAATGGGGCTCAGCCAACACCCCTGTTCCTGGGGCTCCTGCTCCCCACTCCAGCTAA
ORF Protein Sequence MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0357-Ab Anti-MSMP/ PSMP functional antibody
    Target Antigen GM-Tg-g-SE0357-Ag MSMP protein
    ORF Viral Vector pGMLP004703 Human PSMP Lentivirus plasmid
    ORF Viral Vector vGMLP004703 Human PSMP Lentivirus particle


    Target information

    Target ID GM-SE0357
    Target Name MSMP
    Gene ID 692094, 100039672, 696486, 100365008, 101094056, 611944, 100295064, 100629853
    Gene Symbol and Synonyms MSMP,PSMP
    Uniprot Accession Q1L6U9
    Uniprot Entry Name MSMP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000215183
    Target Classification Not Available

    This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.