Human PSMP/PSMP ORF/cDNA clone-Lentivirus particle (NM_001044264)
Cat. No.: vGMLP004703
Pre-made Human PSMP/PSMP Lentiviral expression plasmid for PSMP lentivirus packaging, PSMP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MSMP/PSMP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004703 | Human PSMP Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004703 |
Gene Name | PSMP |
Accession Number | NM_001044264 |
Gene ID | 692094 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 420 bp |
Gene Alias | PSMP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCCTAAGGATGCTCTGGGCTGGACAGGCCAAGGGGATCCTAGGAGGCTGGGGGATCATCTGCTTGGTGATGTCTCTACTCCTCCAGCACCCAGGAGTCTACAGCAAGTGCTACTTCCAAGCTCAAGCCCCCTGTCACTATGAGGGGAAATATTTTACCCTGGGTGAGTCTTGGCTCCGCAAGGACTGTTTCCATTGCACCTGTCTGCATCCTGTTGGCGTGGGCTGCTGTGACACGTCCCAGCATCCCATCGACTTCCCGGCTGGGTGTGAGGTACGTCAGGAGGCAGGAACCTGCCAGTTCTCCTTGGTGCAAAAATCTGACCCTCGGCTGCCCTGCAAAGGGGGAGGGCCTGACCCAGAATGGGGCTCAGCCAACACCCCTGTTCCTGGGGCTCCTGCTCCCCACTCCAGCTAA |
ORF Protein Sequence | MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0357-Ab | Anti-MSMP/ PSMP functional antibody |
Target Antigen | GM-Tg-g-SE0357-Ag | MSMP protein |
ORF Viral Vector | pGMLP004703 | Human PSMP Lentivirus plasmid |
ORF Viral Vector | vGMLP004703 | Human PSMP Lentivirus particle |
Target information
Target ID | GM-SE0357 |
Target Name | MSMP |
Gene ID | 692094, 100039672, 696486, 100365008, 101094056, 611944, 100295064, 100629853 |
Gene Symbol and Synonyms | MSMP,PSMP |
Uniprot Accession | Q1L6U9 |
Uniprot Entry Name | MSMP_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000215183 |
Target Classification | Not Available |
This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.