Human MOG/BTN6/BTNL11 ORF/cDNA clone-Lentivirus plasmid (NM_002433)
Cat. No.: pGMLP004771
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MOG/BTN6/BTNL11 Lentiviral expression plasmid for MOG lentivirus packaging, MOG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MOG/BTN6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004771 |
Gene Name | MOG |
Accession Number | NM_002433 |
Gene ID | 4340 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 759 bp |
Gene Alias | BTN6,BTNL11,MOGIG2,NRCLP7 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCAAGCTTATCAAGACCCTCTCTGCCCAGCTGCCTCTGCTCCTTCCTCCTCCTCCTCCTCCTCCAAGTGTCTTCCAGCTATGCAGGGCAGTTCAGAGTGATAGGACCAAGACACCCTATCCGGGCTCTGGTCGGGGATGAAGTGGAATTGCCATGTCGCATATCTCCTGGGAAGAACGCTACAGGCATGGAGGTGGGGTGGTACCGCCCCCCCTTCTCTAGGGTGGTTCATCTCTACAGAAATGGCAAGGACCAAGATGGAGACCAGGCACCTGAATATCGGGGCCGGACAGAGCTGCTGAAAGATGCTATTGGTGAGGGAAAGGTGACTCTCAGGATCCGGAATGTAAGGTTCTCAGATGAAGGAGGTTTCACCTGCTTCTTCCGAGATCATTCTTACCAAGAGGAGGCAGCAATGGAATTGAAAGTAGAAGATCCTTTCTACTGGGTGAGCCCTGGAGTGCTGGTTCTCCTCGCGGTGCTGCCTGTGCTCCTCCTGCAGATCACTGTTGGCCTCATCTTCCTCTGCCTGCAGTACAGACTGAGAGGAAAACTTCGAGCAGAGATAGAGAATCTCCACCGGACTTTTGATCCCCACTTTCTGAGGGTGCCCTGCTGGAAGATAACCCTGTTTGTAATTGTGCCGGTTCTTGGACCCTTGGTTGCCTTGATCATCTGCTACAACTGGCTACATCGAAGACTAGCAGGGCAATTCCTTGAAGAGCTACTCTTCCACCTGGAAGCCCTCTCTGGCTAA |
ORF Protein Sequence | MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELLFHLEALSG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T00295-Ab | Anti-MOG/ BTN6/ BTNL11IG2 monoclonal antibody |
Target Antigen | GM-Tg-g-T00295-Ag | MOG VLP (virus-like particle) |
ORF Viral Vector | pGMLP004771 | Human MOG Lentivirus plasmid |
ORF Viral Vector | vGMLP004771 | Human MOG Lentivirus particle |
Target information
Target ID | GM-T00295 |
Target Name | MOG |
Gene ID | 4340, 17441, 711347, 24558, 101099378, 119867729, 280863, 100051908 |
Gene Symbol and Synonyms | B230317G11Rik,BTN6,BTNL11,MOG,MOGIG2,NRCLP7 |
Uniprot Accession | Q16653 |
Uniprot Entry Name | MOG_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Diagnostics Biomarker |
Disease | Not Available |
Gene Ensembl | ENSG00000204655 |
Target Classification | Not Available |
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.