Human CSHL1/CS-5/CSHP1 ORF/cDNA clone-Lentivirus plasmid (NM_022579)

Cat. No.: pGMLP004813
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CSHL1/CS-5/CSHP1 Lentiviral expression plasmid for CSHL1 lentivirus packaging, CSHL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CSHL1/CS-5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $467.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004813
Gene Name CSHL1
Accession Number NM_022579
Gene ID 1444
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 669 bp
Gene Alias CS-5,CSHP1,CSL,GHB4,hCS-L
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGCCCTGCTCTGCCTGCCCTGGCTTCAAGAGGCTGGTGCCGTCCAAACCGTTCCCTTATCCAGGCTTTTTAAAGAGGCTATGCTCCAAGCCCATCGCGCACACCAGCTGGCCATTGACACCTACCAGGAGTTTATAAGCTCTTGGGGAATGGAAGCCTATATCACAAAGGAACAGAAGTATTCATTCCTGCATGACTCCCAGACCTCCTTCTGCTTCTCAGACTCTATTCCGACATCCTCCAACATGGAGGAAACGCAGCAGAAATCCAACTTAGAGCTGCTCCACATCTCCCTGCTGCTCATCGAGTCGCGGCTGGAGCCCGTGCGGTTCCTCAGGAGTACCTTCACCAACAACCTGGTGTATGACACCTCGGACAGCGATGACTATCACCTCCTAAAGGACCTAGAGGAAGGCATCCAAATGCTGATGGGGAGGCTGGAAGACGGCAGCCACCTGACTGGGCAGACCCTCAAGCAGACCTACAGCAAGTTTGACACAAACTCGCACAACCATGACGCACTGCTCAAGAACTACGGGCTGCTCCACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATGGTGCAGTGCCGCTCTGTGGAGGGCAGCTGTGGCTTCTAG
ORF Protein Sequence MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0828-Ab Anti-CSHL/ CSHL1/ CS-5 functional antibody
    Target Antigen GM-Tg-g-SE0828-Ag CSHL1 protein
    ORF Viral Vector pGMLP004813 Human CSHL1 Lentivirus plasmid
    ORF Viral Vector vGMLP004813 Human CSHL1 Lentivirus particle


    Target information

    Target ID GM-SE0828
    Target Name CSHL1
    Gene ID 1444
    Gene Symbol and Synonyms CS-5,CSHL1,CSHP1,CSL,GHB4,hCS-L
    Uniprot Accession Q14406
    Uniprot Entry Name CSHL_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000204414
    Target Classification Not Available

    The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.