Human SECTM1/K12 ORF/cDNA clone-Lentivirus plasmid (NM_003004)

Cat. No.: pGMLP004924
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SECTM1/K12 Lentiviral expression plasmid for SECTM1 lentivirus packaging, SECTM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SECTM1/K12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004924
Gene Name SECTM1
Accession Number NM_003004
Gene ID 6398
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 747 bp
Gene Alias K12
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGACCTGCCCCCTGGCATTCCCTGGCCACGTTTCCCAGGCCCTTGGGACCCTCCTGTTTTTGGCTGCCTCCTTGAGTGCTCAGAATGAAGGCTGGGACAGCCCCATCTGCACAGAGGGGGTAGTCTCTGTGTCTTGGGGCGAGAACACCGTCATGTCCTGCAACATCTCCAACGCCTTCTCCCATGTCAACATCAAGCTGCGTGCCCACGGGCAGGAGAGCGCCATCTTCAATGAGGTGGCTCCAGGCTACTTCTCCCGGGACGGCTGGCAGCTCCAGGTTCAGGGAGGCGTGGCACAGCTGGTGATCAAAGGCGCCCGGGACTCCCATGCTGGGCTGTACATGTGGCACCTCGTGGGACACCAGAGAAATAACAGACAAGTCACGCTGGAGGTTTCAGGTGCAGAACCCCAGTCCGCCCCCGACACTGGGTTCTGGCCTGTGCCAGCGGTGGTCACTGCTGTCTTCATCCTCTTGGTCGCTCTGGTCATGTTCGCCTGGTACAGGTGCCGCTGTTCCCAGCAACGCCGGGAGAAGAAGTTCTTCCTCCTAGAACCCCAGATGAAGGTCGCAGCCCTCAGAGCGGGAGCCCAGCAGGGCCTGAGCAGAGCCTCCGCTGAACTGTGGACCCCAGACTCCGAGCCCACCCCAAGGCCGCTGGCACTGGTGTTCAAACCCTCACCACTTGGAGCCCTGGAGCTGCTGTCCCCCCAACCCTTGTTTCCATATGCCGCAGACCCATAG
ORF Protein Sequence MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1499-Ab Anti-SCTM1/ SECTM1/ K12 monoclonal antibody
    Target Antigen GM-Tg-g-MP1499-Ag SECTM1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004924 Human SECTM1 Lentivirus plasmid
    ORF Viral Vector pGMPC000359 Human SECTM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004924 Human SECTM1 Lentivirus particle


    Target information

    Target ID GM-MP1499
    Target Name SECTM1
    Gene ID 6398, 716007, 102152928, 100629534
    Gene Symbol and Synonyms K12,SECTM,SECTM1
    Uniprot Accession Q8WVN6
    Uniprot Entry Name SCTM1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000141574
    Target Classification Not Available

    This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.