Human Nppc/CNP/CNP2 ORF/cDNA clone-Lentivirus plasmid (NM_024409)
Cat. No.: pGMLP004949
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human Nppc/CNP/CNP2 Lentiviral expression plasmid for Nppc lentivirus packaging, Nppc lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NPPC/Nppc/CNP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004949 |
Gene Name | Nppc |
Accession Number | NM_024409 |
Gene ID | 4880 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 381 bp |
Gene Alias | CNP,CNP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCATCTCTCCCAGCTGCTGGCCTGCGCCCTGCTGCTCACGCTGCTCTCCCTCCGGCCCTCCGAAGCCAAGCCCGGGGCGCCGCCGAAGGTCCCGCGAACCCCGCCGGCAGAGGAGCTGGCCGAGCCGCAGGCTGCGGGCGGCGGTCAGAAGAAGGGCGACAAGGCTCCCGGGGGCGGGGGCGCCAATCTCAAGGGCGACCGGTCGCGACTGCTCCGGGACCTGCGCGTGGACACCAAGTCGCGGGCAGCGTGGGCTCGCCTTCTGCAAGAGCACCCCAACGCGCGCAAATACAAAGGAGCCAACAAGAAGGGCTTGTCCAAGGGCTGCTTCGGCCTCAAGCTGGACCGAATCGGCTCCATGAGCGGCCTGGGATGTTAG |
ORF Protein Sequence | MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T87689-Ab | Anti-ANFC/ NPPC/ CNP functional antibody |
Target Antigen | GM-Tg-g-T87689-Ag | NPPC protein |
ORF Viral Vector | pGMLP004949 | Human Nppc Lentivirus plasmid |
ORF Viral Vector | vGMLP004949 | Human Nppc Lentivirus particle |
Target information
Target ID | GM-T87689 |
Target Name | NPPC |
Gene ID | 4880, 18159, 717026, 114593, 101097827, 610169, 281356, 100057178 |
Gene Symbol and Synonyms | CNP,CNP2,lbab,NPPC |
Uniprot Accession | P23582 |
Uniprot Entry Name | ANFC_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000163273 |
Target Classification | Not Available |
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded peptides exhibit vasorelaxation activity in laboratory animals and elevated levels of CNP-22 have been observed in the plasma of chronic heart failure patients. [provided by RefSeq, Oct 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.